BLASTX nr result
ID: Perilla23_contig00019067
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00019067 (460 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004242501.1| PREDICTED: mitochondrial import inner membra... 61 4e-07 ref|XP_012857978.1| PREDICTED: mitochondrial import inner membra... 60 5e-07 ref|XP_009629060.1| PREDICTED: mitochondrial import inner membra... 58 3e-06 ref|XP_009792241.1| PREDICTED: mitochondrial import inner membra... 56 9e-06 ref|XP_009783304.1| PREDICTED: mitochondrial import inner membra... 56 9e-06 ref|XP_009629055.1| PREDICTED: mitochondrial import inner membra... 56 9e-06 >ref|XP_004242501.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM17-2-like [Solanum lycopersicum] Length = 236 Score = 60.8 bits (146), Expect = 4e-07 Identities = 29/37 (78%), Positives = 31/37 (83%), Gaps = 2/37 (5%) Frame = -3 Query: 458 GGLFGGN--EETAPSDGSKAKVLESFDAPNPPAFEYK 354 GGLFGG EETAP+ GSK +VLESFDAPNPP FEYK Sbjct: 200 GGLFGGGKKEETAPNGGSKTQVLESFDAPNPPTFEYK 236 >ref|XP_012857978.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM17-2 [Erythranthe guttatus] gi|604300590|gb|EYU20408.1| hypothetical protein MIMGU_mgv1a013360mg [Erythranthe guttata] Length = 222 Score = 60.5 bits (145), Expect = 5e-07 Identities = 29/36 (80%), Positives = 30/36 (83%), Gaps = 1/36 (2%) Frame = -3 Query: 458 GGLFGGN-EETAPSDGSKAKVLESFDAPNPPAFEYK 354 GGLFGG EE PSDGSK KVLESFDAP PP+FEYK Sbjct: 187 GGLFGGEKEEAGPSDGSKTKVLESFDAPAPPSFEYK 222 >ref|XP_009629060.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM17-2-like [Nicotiana tomentosiformis] Length = 235 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/37 (75%), Positives = 31/37 (83%), Gaps = 2/37 (5%) Frame = -3 Query: 458 GGLFGGN--EETAPSDGSKAKVLESFDAPNPPAFEYK 354 GGLFGG EETA + GSK +VLESFDAP+PPAFEYK Sbjct: 199 GGLFGGGKKEETATNSGSKTQVLESFDAPSPPAFEYK 235 >ref|XP_009792241.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM17-2-like [Nicotiana sylvestris] gi|698491670|ref|XP_009792242.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM17-2-like [Nicotiana sylvestris] gi|698491673|ref|XP_009792243.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM17-2-like [Nicotiana sylvestris] gi|698491675|ref|XP_009792244.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM17-2-like [Nicotiana sylvestris] gi|698491677|ref|XP_009792245.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM17-2-like [Nicotiana sylvestris] Length = 236 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/37 (72%), Positives = 30/37 (81%), Gaps = 2/37 (5%) Frame = -3 Query: 458 GGLFGGN--EETAPSDGSKAKVLESFDAPNPPAFEYK 354 GGLFGG EETA + GSK +VLESFDAP+PP FEYK Sbjct: 200 GGLFGGGKKEETATNSGSKTQVLESFDAPSPPTFEYK 236 >ref|XP_009783304.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM17-2-like [Nicotiana sylvestris] Length = 236 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/37 (72%), Positives = 30/37 (81%), Gaps = 2/37 (5%) Frame = -3 Query: 458 GGLFGGN--EETAPSDGSKAKVLESFDAPNPPAFEYK 354 GGLFGG EETA + GSK +VLESFDAP+PP FEYK Sbjct: 200 GGLFGGGKKEETATNSGSKTQVLESFDAPSPPTFEYK 236 >ref|XP_009629055.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM17-2-like [Nicotiana tomentosiformis] gi|697149694|ref|XP_009629056.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM17-2-like [Nicotiana tomentosiformis] gi|697149696|ref|XP_009629057.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM17-2-like [Nicotiana tomentosiformis] gi|697149698|ref|XP_009629058.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM17-2-like [Nicotiana tomentosiformis] gi|697149700|ref|XP_009629059.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM17-2-like [Nicotiana tomentosiformis] Length = 236 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/37 (72%), Positives = 30/37 (81%), Gaps = 2/37 (5%) Frame = -3 Query: 458 GGLFGGN--EETAPSDGSKAKVLESFDAPNPPAFEYK 354 GGLFGG EETA + GSK +VLESFDAP+PP FEYK Sbjct: 200 GGLFGGGKKEETATNSGSKTQVLESFDAPSPPTFEYK 236