BLASTX nr result
ID: Perilla23_contig00018923
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00018923 (445 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012837222.1| PREDICTED: serine/threonine-protein kinase E... 64 6e-08 ref|XP_012833775.1| PREDICTED: serine/threonine-protein kinase H... 59 2e-06 ref|XP_012833774.1| PREDICTED: uncharacterized protein LOC105954... 59 2e-06 gb|EYU40458.1| hypothetical protein MIMGU_mgv1a003866mg [Erythra... 59 2e-06 ref|XP_011088655.1| PREDICTED: serine/threonine-protein kinase H... 57 4e-06 gb|KGN43282.1| hypothetical protein Csa_7G017160 [Cucumis sativus] 57 4e-06 ref|XP_008447912.1| PREDICTED: serine/threonine-protein kinase H... 57 4e-06 ref|XP_004144866.1| PREDICTED: serine/threonine-protein kinase H... 57 4e-06 >ref|XP_012837222.1| PREDICTED: serine/threonine-protein kinase EDR1 [Erythranthe guttatus] gi|604333644|gb|EYU37995.1| hypothetical protein MIMGU_mgv1a003777mg [Erythranthe guttata] Length = 564 Score = 63.5 bits (153), Expect = 6e-08 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -2 Query: 123 MVMEDKESCGSRRVEKTSSAKSRAQQKKTEVYNEVLRRLKE 1 MVMED ESCGSR VE +SSAKSR QQKK EV+NEVLRRLKE Sbjct: 1 MVMEDNESCGSRVVE-SSSAKSRQQQKKVEVFNEVLRRLKE 40 >ref|XP_012833775.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X2 [Erythranthe guttatus] Length = 562 Score = 58.5 bits (140), Expect = 2e-06 Identities = 31/44 (70%), Positives = 34/44 (77%), Gaps = 3/44 (6%) Frame = -2 Query: 123 MVMEDKESCGSRRVEKTSSA---KSRAQQKKTEVYNEVLRRLKE 1 M MED ESCGSRRV+ S+A KS Q+KK EVYNEVLRRLKE Sbjct: 1 MAMEDNESCGSRRVDSPSAAAATKSLRQRKKVEVYNEVLRRLKE 44 >ref|XP_012833774.1| PREDICTED: uncharacterized protein LOC105954650 isoform X1 [Erythranthe guttatus] Length = 603 Score = 58.5 bits (140), Expect = 2e-06 Identities = 31/44 (70%), Positives = 34/44 (77%), Gaps = 3/44 (6%) Frame = -2 Query: 123 MVMEDKESCGSRRVEKTSSA---KSRAQQKKTEVYNEVLRRLKE 1 M MED ESCGSRRV+ S+A KS Q+KK EVYNEVLRRLKE Sbjct: 1 MAMEDNESCGSRRVDSPSAAAATKSLRQRKKVEVYNEVLRRLKE 44 >gb|EYU40458.1| hypothetical protein MIMGU_mgv1a003866mg [Erythranthe guttata] Length = 559 Score = 58.5 bits (140), Expect = 2e-06 Identities = 31/44 (70%), Positives = 34/44 (77%), Gaps = 3/44 (6%) Frame = -2 Query: 123 MVMEDKESCGSRRVEKTSSA---KSRAQQKKTEVYNEVLRRLKE 1 M MED ESCGSRRV+ S+A KS Q+KK EVYNEVLRRLKE Sbjct: 1 MAMEDNESCGSRRVDSPSAAAATKSLRQRKKVEVYNEVLRRLKE 44 >ref|XP_011088655.1| PREDICTED: serine/threonine-protein kinase HT1 [Sesamum indicum] Length = 562 Score = 57.4 bits (137), Expect = 4e-06 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = -2 Query: 123 MVMEDKESCGSRRVEKTSSAKSRAQQKKTEVYNEVLRRLKE 1 MVMED ESC SR VE +S+ K+R Q+KK EVYNEVLRRLKE Sbjct: 1 MVMEDNESCASRVVE-SSAGKTRLQRKKVEVYNEVLRRLKE 40 >gb|KGN43282.1| hypothetical protein Csa_7G017160 [Cucumis sativus] Length = 536 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -2 Query: 123 MVMEDKESCGSRRVEKTSSAKSRAQQKKTEVYNEVLRRLKE 1 MVMED ESCGSR + S A+SR Q++K EVYNEVLRRLK+ Sbjct: 1 MVMEDNESCGSRAYDLLSPAQSRQQRQKFEVYNEVLRRLKD 41 >ref|XP_008447912.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X1 [Cucumis melo] Length = 572 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -2 Query: 123 MVMEDKESCGSRRVEKTSSAKSRAQQKKTEVYNEVLRRLKE 1 MVMED ESCGSR + S A+SR Q++K EVYNEVLRRLK+ Sbjct: 1 MVMEDNESCGSRAYDLLSPAQSRQQRQKFEVYNEVLRRLKD 41 >ref|XP_004144866.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X1 [Cucumis sativus] Length = 573 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -2 Query: 123 MVMEDKESCGSRRVEKTSSAKSRAQQKKTEVYNEVLRRLKE 1 MVMED ESCGSR + S A+SR Q++K EVYNEVLRRLK+ Sbjct: 1 MVMEDNESCGSRAYDLLSPAQSRQQRQKFEVYNEVLRRLKD 41