BLASTX nr result
ID: Perilla23_contig00018749
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00018749 (346 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012827932.1| PREDICTED: P-loop NTPase domain-containing p... 58 3e-06 ref|XP_012838604.1| PREDICTED: P-loop NTPase domain-containing p... 57 4e-06 ref|XP_012838605.1| PREDICTED: P-loop NTPase domain-containing p... 57 4e-06 >ref|XP_012827932.1| PREDICTED: P-loop NTPase domain-containing protein LPA1 homolog 2-like [Erythranthe guttatus] gi|848928824|ref|XP_012827933.1| PREDICTED: P-loop NTPase domain-containing protein LPA1 homolog 2-like [Erythranthe guttatus] gi|604298831|gb|EYU18801.1| hypothetical protein MIMGU_mgv1a002235mg [Erythranthe guttata] Length = 697 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = +3 Query: 216 MVAAEGVAKPLYIVVLEDDAAPAAEKGGPPSFRYTRSVLQSTL 344 M EG+ K LYI+VLED+A A+K PSFRYTRSVLQSTL Sbjct: 1 MAVPEGLTKLLYIIVLEDEATAGADKNDTPSFRYTRSVLQSTL 43 >ref|XP_012838604.1| PREDICTED: P-loop NTPase domain-containing protein LPA1 homolog 2-like isoform X1 [Erythranthe guttatus] Length = 731 Score = 57.4 bits (137), Expect = 4e-06 Identities = 32/44 (72%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +3 Query: 216 MVAAEGVAKPLYIVVLEDD-AAPAAEKGGPPSFRYTRSVLQSTL 344 M AAEG++K LYIVV++DD AA AAEK SFRYTRSVLQSTL Sbjct: 1 MAAAEGLSKLLYIVVVDDDGAAAAAEKKNSSSFRYTRSVLQSTL 44 >ref|XP_012838605.1| PREDICTED: P-loop NTPase domain-containing protein LPA1 homolog 2-like isoform X2 [Erythranthe guttatus] gi|604331306|gb|EYU36164.1| hypothetical protein MIMGU_mgv1a001992mg [Erythranthe guttata] Length = 729 Score = 57.4 bits (137), Expect = 4e-06 Identities = 32/44 (72%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +3 Query: 216 MVAAEGVAKPLYIVVLEDD-AAPAAEKGGPPSFRYTRSVLQSTL 344 M AAEG++K LYIVV++DD AA AAEK SFRYTRSVLQSTL Sbjct: 1 MAAAEGLSKLLYIVVVDDDGAAAAAEKKNSSSFRYTRSVLQSTL 44