BLASTX nr result
ID: Perilla23_contig00018683
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00018683 (385 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35039.1| hypothetical protein MIMGU_mgv1a003370mg [Erythra... 54 2e-07 >gb|EYU35039.1| hypothetical protein MIMGU_mgv1a003370mg [Erythranthe guttata] Length = 589 Score = 53.5 bits (127), Expect(2) = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 140 AMKLKNPSNSASQTLTSSDTRLLVRETLRI 51 AMKLK PSNSASQTLTSS+TRLLVRET RI Sbjct: 76 AMKLKQPSNSASQTLTSSETRLLVRETFRI 105 Score = 28.1 bits (61), Expect(2) = 2e-07 Identities = 20/40 (50%), Positives = 26/40 (65%), Gaps = 1/40 (2%) Frame = -1 Query: 379 HTHSLSL-SPLFLKREKEEG*SRSITIATKSQQENPSLIL 263 +T SLSL SPL RE+++ ++ TKSQQEN SL L Sbjct: 10 YTLSLSLLSPLSSPRERKK--EEELSKTTKSQQENLSLSL 47