BLASTX nr result
ID: Perilla23_contig00018660
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00018660 (338 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012858107.1| PREDICTED: AT-hook motif nuclear-localized p... 58 2e-06 ref|XP_011085041.1| PREDICTED: putative DNA-binding protein ESCA... 56 9e-06 >ref|XP_012858107.1| PREDICTED: AT-hook motif nuclear-localized protein 15 [Erythranthe guttatus] gi|604300092|gb|EYU19935.1| hypothetical protein MIMGU_mgv1a017709mg [Erythranthe guttata] Length = 322 Score = 58.2 bits (139), Expect = 2e-06 Identities = 34/77 (44%), Positives = 46/77 (59%), Gaps = 16/77 (20%) Frame = -1 Query: 227 MGSRWWAE--MANPMQSS---------LHLRNSAEDENAA----VFNAGDHNPNHNPED- 96 M +RWWA + NPM SS LHLRN++EDENAA + N+ NPN NP+D Sbjct: 1 MANRWWAGNVVMNPMSSSPSGGGGGPSLHLRNNSEDENAALNHNLSNSSGSNPNQNPDDG 60 Query: 95 EEIDEDHTNLSGDPEVA 45 + +E H N +GD E++ Sbjct: 61 DNYEEAHQNPTGDIEIS 77 >ref|XP_011085041.1| PREDICTED: putative DNA-binding protein ESCAROLA [Sesamum indicum] Length = 299 Score = 56.2 bits (134), Expect = 9e-06 Identities = 38/75 (50%), Positives = 44/75 (58%), Gaps = 16/75 (21%) Frame = -1 Query: 227 MGSRWWAEM--ANPMQSS----LHLRNSAEDENAAVFNAGD---HNPNHNPEDEE----- 90 M +RWWAE NPM SS LHLR+SAEDEN A NA + NPN NP++ E Sbjct: 1 MANRWWAEAMATNPMSSSAAASLHLRSSAEDENPAFNNASNSSGSNPNQNPDEGENHDIL 60 Query: 89 --IDEDHTNLSGDPE 51 D+D NLSGD E Sbjct: 61 DGQDQDQ-NLSGDLE 74