BLASTX nr result
ID: Perilla23_contig00018616
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00018616 (342 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009784108.1| PREDICTED: UDP-glucuronate 4-epimerase 3-lik... 69 1e-09 ref|XP_006345514.1| PREDICTED: UDP-glucuronate 4-epimerase 3-lik... 69 1e-09 ref|XP_004240046.1| PREDICTED: UDP-glucuronate 4-epimerase 3-lik... 69 1e-09 emb|CDO97699.1| unnamed protein product [Coffea canephora] 68 3e-09 ref|XP_006347877.1| PREDICTED: UDP-glucuronate 4-epimerase 3-lik... 68 3e-09 ref|XP_004229804.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [So... 68 3e-09 ref|XP_009596624.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Ni... 67 4e-09 ref|XP_004248561.1| PREDICTED: UDP-glucuronate 4-epimerase 3-lik... 67 7e-09 ref|XP_009591830.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Ni... 66 9e-09 ref|XP_009590502.1| PREDICTED: UDP-glucuronate 4-epimerase 3-lik... 66 9e-09 ref|XP_009781950.1| PREDICTED: UDP-glucuronate 4-epimerase 3-lik... 65 2e-08 ref|XP_012843933.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Er... 65 3e-08 gb|EYU31982.1| hypothetical protein MIMGU_mgv1a012102mg [Erythra... 65 3e-08 ref|XP_011090565.1| PREDICTED: UDP-glucuronate 4-epimerase 3-lik... 64 3e-08 gb|KFK37325.1| hypothetical protein AALP_AA4G242100 [Arabis alpina] 62 1e-07 ref|XP_012845600.1| PREDICTED: UDP-glucuronate 4-epimerase 3-lik... 62 2e-07 ref|XP_013725818.1| PREDICTED: UDP-glucuronate 4-epimerase 4-lik... 61 3e-07 ref|XP_013734806.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Br... 61 3e-07 ref|XP_013611476.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Br... 61 3e-07 ref|XP_010098924.1| UDP-glucuronate 4-epimerase 3 [Morus notabil... 61 3e-07 >ref|XP_009784108.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana sylvestris] Length = 435 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 342 GYKPTTDLQTGLKKFARWYLSYYGNGKKSAQ 250 GYKPTTDLQTGLKKF RWYLSYYGNGKKSAQ Sbjct: 405 GYKPTTDLQTGLKKFVRWYLSYYGNGKKSAQ 435 >ref|XP_006345514.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum] Length = 435 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 342 GYKPTTDLQTGLKKFARWYLSYYGNGKKSAQ 250 GYKPTTDLQTGLKKF RWYLSYYGNGKKSAQ Sbjct: 405 GYKPTTDLQTGLKKFVRWYLSYYGNGKKSAQ 435 >ref|XP_004240046.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum lycopersicum] Length = 435 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 342 GYKPTTDLQTGLKKFARWYLSYYGNGKKSAQ 250 GYKPTTDLQTGLKKF RWYLSYYGNGKKSAQ Sbjct: 405 GYKPTTDLQTGLKKFVRWYLSYYGNGKKSAQ 435 >emb|CDO97699.1| unnamed protein product [Coffea canephora] Length = 437 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 342 GYKPTTDLQTGLKKFARWYLSYYGNGKKSAQ 250 GYKPTTDLQTGLKKF RWYLSYYGNGKKS+Q Sbjct: 407 GYKPTTDLQTGLKKFVRWYLSYYGNGKKSSQ 437 >ref|XP_006347877.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum] Length = 435 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 342 GYKPTTDLQTGLKKFARWYLSYYGNGKKSAQ 250 GYKPTTDLQTGLKKF RWYL+YYGNGKKSAQ Sbjct: 405 GYKPTTDLQTGLKKFVRWYLNYYGNGKKSAQ 435 >ref|XP_004229804.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Solanum lycopersicum] Length = 435 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 342 GYKPTTDLQTGLKKFARWYLSYYGNGKKSAQ 250 GYKPTTDLQTGLKKF RWYL+YYGNGKKSAQ Sbjct: 405 GYKPTTDLQTGLKKFVRWYLNYYGNGKKSAQ 435 >ref|XP_009596624.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis] Length = 435 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -1 Query: 342 GYKPTTDLQTGLKKFARWYLSYYGNGKKSAQ 250 GYKPTTDLQTGLKKF RWYLSYYGNGKKS Q Sbjct: 405 GYKPTTDLQTGLKKFVRWYLSYYGNGKKSVQ 435 >ref|XP_004248561.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum lycopersicum] Length = 435 Score = 66.6 bits (161), Expect = 7e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -1 Query: 342 GYKPTTDLQTGLKKFARWYLSYYGNGKKSAQ 250 GYKPTTDLQTGLKKF RWYLSYYG GKKSAQ Sbjct: 405 GYKPTTDLQTGLKKFVRWYLSYYGEGKKSAQ 435 >ref|XP_009591830.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis] gi|697166040|ref|XP_009591831.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis] gi|698514475|ref|XP_009802117.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana sylvestris] Length = 435 Score = 66.2 bits (160), Expect = 9e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 342 GYKPTTDLQTGLKKFARWYLSYYGNGKKSAQ 250 GYKP+TDLQTGLKKF RWYL+YYGNGKKSAQ Sbjct: 405 GYKPSTDLQTGLKKFVRWYLNYYGNGKKSAQ 435 >ref|XP_009590502.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana tomentosiformis] Length = 65 Score = 66.2 bits (160), Expect = 9e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 342 GYKPTTDLQTGLKKFARWYLSYYGNGKKSAQ 250 GYKP+TDLQTGLKKF RWYL+YYGNGKKSAQ Sbjct: 35 GYKPSTDLQTGLKKFVRWYLNYYGNGKKSAQ 65 >ref|XP_009781950.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana sylvestris] Length = 436 Score = 65.5 bits (158), Expect = 2e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 342 GYKPTTDLQTGLKKFARWYLSYYGNGKKSAQ 250 GYKPTTDLQTGLKKF RWYLSYYG+GKKS Q Sbjct: 406 GYKPTTDLQTGLKKFVRWYLSYYGDGKKSVQ 436 >ref|XP_012843933.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Erythranthe guttatus] Length = 317 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 342 GYKPTTDLQTGLKKFARWYLSYYGNGKKSAQ 250 GYKPTTDLQTGLKKF RWYLSYYGN KKS+Q Sbjct: 287 GYKPTTDLQTGLKKFVRWYLSYYGNEKKSSQ 317 >gb|EYU31982.1| hypothetical protein MIMGU_mgv1a012102mg [Erythranthe guttata] Length = 261 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 342 GYKPTTDLQTGLKKFARWYLSYYGNGKKSAQ 250 GYKPTTDLQTGLKKF RWYLSYYGN KKS+Q Sbjct: 231 GYKPTTDLQTGLKKFVRWYLSYYGNEKKSSQ 261 >ref|XP_011090565.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Sesamum indicum] gi|747044738|ref|XP_011090567.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Sesamum indicum] Length = 432 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 342 GYKPTTDLQTGLKKFARWYLSYYGNGKKSAQ 250 GYKPTTDLQTGLKKF RWYL+YY NGKKSAQ Sbjct: 402 GYKPTTDLQTGLKKFVRWYLNYYVNGKKSAQ 432 >gb|KFK37325.1| hypothetical protein AALP_AA4G242100 [Arabis alpina] Length = 435 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = -1 Query: 342 GYKPTTDLQTGLKKFARWYLSYYGNGKKSA 253 GYKPTTDLQTGLKKF RWYLSYY GKKSA Sbjct: 404 GYKPTTDLQTGLKKFVRWYLSYYSGGKKSA 433 >ref|XP_012845600.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Erythranthe guttatus] gi|604319352|gb|EYU30554.1| hypothetical protein MIMGU_mgv1a006591mg [Erythranthe guttata] Length = 438 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 342 GYKPTTDLQTGLKKFARWYLSYYGNGKKSAQ 250 GYKP+TDLQTGLKKF +WYLSYY NGKK+AQ Sbjct: 408 GYKPSTDLQTGLKKFVQWYLSYYENGKKAAQ 438 >ref|XP_013725818.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like [Brassica napus] Length = 151 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -1 Query: 342 GYKPTTDLQTGLKKFARWYLSYYGNGKKSA 253 GYKPTTDLQTGLKKF RWYLSYY GKK+A Sbjct: 120 GYKPTTDLQTGLKKFVRWYLSYYSGGKKAA 149 >ref|XP_013734806.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Brassica napus] Length = 435 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -1 Query: 342 GYKPTTDLQTGLKKFARWYLSYYGNGKKSA 253 GYKPTTDLQTGLKKF RWYLSYY GKK+A Sbjct: 404 GYKPTTDLQTGLKKFVRWYLSYYSGGKKAA 433 >ref|XP_013611476.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Brassica oleracea var. oleracea] Length = 430 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -1 Query: 342 GYKPTTDLQTGLKKFARWYLSYYGNGKKSA 253 GYKPTTDLQTGLKKFARWYL YY GKK+A Sbjct: 400 GYKPTTDLQTGLKKFARWYLGYYNGGKKAA 429 >ref|XP_010098924.1| UDP-glucuronate 4-epimerase 3 [Morus notabilis] gi|587887486|gb|EXB76226.1| UDP-glucuronate 4-epimerase 3 [Morus notabilis] Length = 445 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -1 Query: 342 GYKPTTDLQTGLKKFARWYLSYYGNGKKSAQ 250 GYKPTTDLQTGLKKF RWYLSYY GKK+ Q Sbjct: 415 GYKPTTDLQTGLKKFVRWYLSYYSGGKKAPQ 445