BLASTX nr result
ID: Perilla23_contig00018602
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00018602 (306 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007025554.1| Uncharacterized protein TCM_029816 [Theobrom... 81 3e-13 gb|KMT04609.1| hypothetical protein BVRB_8g182630 [Beta vulgaris... 67 4e-09 gb|KHN18952.1| hypothetical protein glysoja_036131 [Glycine soja] 62 1e-07 ref|XP_002509440.1| pentatricopeptide repeat-containing protein,... 57 7e-06 gb|ABR16782.1| unknown [Picea sitchensis] 56 9e-06 >ref|XP_007025554.1| Uncharacterized protein TCM_029816 [Theobroma cacao] gi|508780920|gb|EOY28176.1| Uncharacterized protein TCM_029816 [Theobroma cacao] Length = 44 Score = 81.3 bits (199), Expect = 3e-13 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = +2 Query: 107 MLELFVLGCTGVVVFLHGANFFFHALSSHLAVRAISFLGFAAW 235 M+ELFVLGCTGVVVFLHGANFFFH LS HLAVR++SFLGF W Sbjct: 2 MVELFVLGCTGVVVFLHGANFFFHILSQHLAVRSLSFLGFVGW 44 >gb|KMT04609.1| hypothetical protein BVRB_8g182630 [Beta vulgaris subsp. vulgaris] Length = 44 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/43 (65%), Positives = 37/43 (86%) Frame = +2 Query: 107 MLELFVLGCTGVVVFLHGANFFFHALSSHLAVRAISFLGFAAW 235 ++ELFVLGCTG+V+F HGA+ FHAL SH+A+R++SFLGF W Sbjct: 2 VVELFVLGCTGMVMFYHGAHVLFHALFSHVALRSLSFLGFVGW 44 >gb|KHN18952.1| hypothetical protein glysoja_036131 [Glycine soja] Length = 78 Score = 62.4 bits (150), Expect = 1e-07 Identities = 26/36 (72%), Positives = 34/36 (94%) Frame = +2 Query: 107 MLELFVLGCTGVVVFLHGANFFFHALSSHLAVRAIS 214 M+E+ VLGCTGVVVFLHGA+FFFHAL+ H+A+R++S Sbjct: 1 MMEVLVLGCTGVVVFLHGAHFFFHALTQHIALRSLS 36 >ref|XP_002509440.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223549339|gb|EEF50827.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 678 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/37 (70%), Positives = 32/37 (86%), Gaps = 2/37 (5%) Frame = +2 Query: 107 MLELFVLG--CTGVVVFLHGANFFFHALSSHLAVRAI 211 ++E+FVLG CTGVV+FLHGANFFFH LS HLA R++ Sbjct: 2 VVEIFVLGMGCTGVVMFLHGANFFFHVLSHHLAFRSL 38 >gb|ABR16782.1| unknown [Picea sitchensis] Length = 41 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/38 (65%), Positives = 34/38 (89%) Frame = +2 Query: 107 MLELFVLGCTGVVVFLHGANFFFHALSSHLAVRAISFL 220 ML+L +LGCTGV+VF+HGANFFF+ + H+AVRA++FL Sbjct: 1 MLDL-LLGCTGVIVFIHGANFFFNYICKHVAVRALTFL 37