BLASTX nr result
ID: Perilla23_contig00018569
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00018569 (401 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011086884.1| PREDICTED: ethylene-responsive transcription... 61 4e-07 ref|XP_006580881.1| PREDICTED: ethylene-responsive transcription... 59 1e-06 >ref|XP_011086884.1| PREDICTED: ethylene-responsive transcription factor ERF113 isoform X1 [Sesamum indicum] Length = 255 Score = 60.8 bits (146), Expect = 4e-07 Identities = 35/68 (51%), Positives = 43/68 (63%), Gaps = 7/68 (10%) Frame = -3 Query: 183 MEASPQKAG-AYGGQTDSSTVISGLTRILGEDSGQDAAVLPP------ETTQQDQGSVKK 25 MEA +K+G AYG + +ISGLTRILG +D A+ PP + QDQ +VKK Sbjct: 1 MEAPGEKSGGAYGFSGGQNNMISGLTRILGATHEEDPALPPPPPPEAPQEAHQDQATVKK 60 Query: 24 HYRGVRQR 1 HYRGVRQR Sbjct: 61 HYRGVRQR 68 >ref|XP_006580881.1| PREDICTED: ethylene-responsive transcription factor ERF114-like [Glycine max] Length = 246 Score = 58.9 bits (141), Expect = 1e-06 Identities = 33/87 (37%), Positives = 51/87 (58%), Gaps = 14/87 (16%) Frame = -3 Query: 219 KVDRRHGKRPLPMEASPQKAGAYG--GQTDSSTVISGLTRILGED-------SGQDAAVL 67 KVDR+HGKRPLP+E + Y Q D S V+S L +++G + + ++V+ Sbjct: 23 KVDRKHGKRPLPLEEEEKAFPIYSSRSQQDISAVVSALVQVIGGNPEHKDPTTASQSSVV 82 Query: 66 PPETTQQD-----QGSVKKHYRGVRQR 1 ++ +Q QG+V++HYRGVRQR Sbjct: 83 GNDSNEQSQPPQHQGNVRRHYRGVRQR 109