BLASTX nr result
ID: Perilla23_contig00017906
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00017906 (517 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22459.1| hypothetical protein MIMGU_mgv1a017102mg [Erythra... 68 3e-09 gb|EPS66009.1| hypothetical protein M569_08770, partial [Genlise... 59 2e-06 >gb|EYU22459.1| hypothetical protein MIMGU_mgv1a017102mg [Erythranthe guttata] Length = 93 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/51 (62%), Positives = 39/51 (76%) Frame = -3 Query: 410 SDRVGEKLGKTKEVASAGFGKTKAVASVGFEKSKVAAGKIKVGASVGFNWV 258 S ++ EK +TKEVAS GF KTK V + GFEK+KVAA K+K GASVG NW+ Sbjct: 30 SKKMSEKFERTKEVASTGFEKTKVVTAAGFEKTKVAAKKVKDGASVGVNWI 80 >gb|EPS66009.1| hypothetical protein M569_08770, partial [Genlisea aurea] Length = 65 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/49 (53%), Positives = 36/49 (73%) Frame = -3 Query: 404 RVGEKLGKTKEVASAGFGKTKAVASVGFEKSKVAAGKIKVGASVGFNWV 258 ++ EK +TK VA+ G KTK A+ G+EK+KVAA K+K GA+VG NW+ Sbjct: 4 KMSEKFDRTKVVAAVGVEKTKVAAAAGYEKTKVAAKKVKQGAAVGVNWI 52