BLASTX nr result
ID: Perilla23_contig00017761
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00017761 (455 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011074049.1| PREDICTED: calvin cycle protein CP12-3, chlo... 61 4e-07 >ref|XP_011074049.1| PREDICTED: calvin cycle protein CP12-3, chloroplastic [Sesamum indicum] Length = 125 Score = 60.8 bits (146), Expect = 4e-07 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -3 Query: 105 RSGRRMMAGVRSEMKVYKGTHMREQRLTEMIEQKV 1 RSGR+ AGVRSEMK+YKGT +REQRLTEMIEQKV Sbjct: 28 RSGRKPAAGVRSEMKIYKGTRIREQRLTEMIEQKV 62