BLASTX nr result
ID: Perilla23_contig00017691
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00017691 (478 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011083185.1| PREDICTED: uncharacterized protein LOC105165... 83 9e-14 ref|XP_009611011.1| PREDICTED: uncharacterized protein LOC104104... 79 1e-12 ref|XP_009793690.1| PREDICTED: uncharacterized protein LOC104240... 79 2e-12 ref|XP_010233766.1| PREDICTED: uncharacterized protein LOC104583... 77 5e-12 ref|XP_009417020.1| PREDICTED: uncharacterized protein LOC103997... 77 5e-12 ref|XP_009396322.1| PREDICTED: uncharacterized protein LOC103981... 77 7e-12 ref|XP_012436849.1| PREDICTED: uncharacterized protein LOC105763... 76 9e-12 ref|XP_011100957.1| PREDICTED: uncharacterized protein LOC105179... 76 1e-11 ref|XP_010275578.1| PREDICTED: uncharacterized protein LOC104610... 76 1e-11 ref|XP_009404012.1| PREDICTED: uncharacterized protein LOC103987... 76 1e-11 ref|XP_010254729.1| PREDICTED: uncharacterized protein LOC104595... 75 1e-11 ref|XP_006340664.1| PREDICTED: uncharacterized protein LOC102593... 75 2e-11 ref|XP_009403897.1| PREDICTED: uncharacterized protein LOC103987... 75 2e-11 ref|XP_009386487.1| PREDICTED: uncharacterized protein LOC103973... 74 4e-11 ref|XP_006585165.1| PREDICTED: uncharacterized protein LOC102669... 74 4e-11 ref|XP_002276079.2| PREDICTED: uncharacterized protein LOC100247... 74 6e-11 ref|XP_009380389.1| PREDICTED: uncharacterized protein LOC103968... 74 6e-11 ref|XP_006473551.1| PREDICTED: uncharacterized protein LOC102624... 74 6e-11 ref|XP_011028507.1| PREDICTED: uncharacterized protein LOC105128... 73 7e-11 ref|XP_008452106.1| PREDICTED: uncharacterized protein LOC103493... 73 9e-11 >ref|XP_011083185.1| PREDICTED: uncharacterized protein LOC105165758 [Sesamum indicum] Length = 43 Score = 82.8 bits (203), Expect = 9e-14 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = +3 Query: 105 IMSAVVSEILLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 230 IMSAV+SEILLSGFT+NSTLRRRSHLVQSFSVVFLYWFYVFS Sbjct: 2 IMSAVLSEILLSGFTVNSTLRRRSHLVQSFSVVFLYWFYVFS 43 >ref|XP_009611011.1| PREDICTED: uncharacterized protein LOC104104584 [Nicotiana tomentosiformis] Length = 45 Score = 79.3 bits (194), Expect = 1e-12 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = +3 Query: 102 QIMSAVVSEILLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 230 +IMS V+SE+LLSGFTINSTL RR+HLVQSFSVVFLYWFYVFS Sbjct: 3 EIMSPVISEVLLSGFTINSTLHRRTHLVQSFSVVFLYWFYVFS 45 >ref|XP_009793690.1| PREDICTED: uncharacterized protein LOC104240532 [Nicotiana sylvestris] Length = 45 Score = 78.6 bits (192), Expect = 2e-12 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = +3 Query: 105 IMSAVVSEILLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 230 IMS V+SE+LLSGFTINSTL RR+HLVQSFSVVFLYWFYVFS Sbjct: 4 IMSPVISEVLLSGFTINSTLHRRTHLVQSFSVVFLYWFYVFS 45 >ref|XP_010233766.1| PREDICTED: uncharacterized protein LOC104583416 [Brachypodium distachyon] gi|944057566|gb|KQJ93156.1| hypothetical protein BRADI_3g02990 [Brachypodium distachyon] Length = 41 Score = 77.0 bits (188), Expect = 5e-12 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +3 Query: 108 MSAVVSEILLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 230 MS V+SEILLSGF INSTLRRR+HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVISEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_009417020.1| PREDICTED: uncharacterized protein LOC103997494 [Musa acuminata subsp. malaccensis] Length = 41 Score = 77.0 bits (188), Expect = 5e-12 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +3 Query: 108 MSAVVSEILLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 230 MS ++SEILLSGF INSTLRRRSHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVFS 41 >ref|XP_009396322.1| PREDICTED: uncharacterized protein LOC103981344 [Musa acuminata subsp. malaccensis] Length = 41 Score = 76.6 bits (187), Expect = 7e-12 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = +3 Query: 108 MSAVVSEILLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 230 MSA++SEILLSGF I+STLRRR+HLVQSFSVVFLYWFYVFS Sbjct: 1 MSAIISEILLSGFMISSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_012436849.1| PREDICTED: uncharacterized protein LOC105763252 [Gossypium raimondii] Length = 41 Score = 76.3 bits (186), Expect = 9e-12 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +3 Query: 108 MSAVVSEILLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 230 MS V+SEILLSGF INSTLRRR+HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_011100957.1| PREDICTED: uncharacterized protein LOC105179060 [Sesamum indicum] Length = 41 Score = 75.9 bits (185), Expect = 1e-11 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +3 Query: 108 MSAVVSEILLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 230 MS V+SEILLSGFT+NS+L RRSHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEILLSGFTVNSSLHRRSHLVQSFSVVFLYWFYVFS 41 >ref|XP_010275578.1| PREDICTED: uncharacterized protein LOC104610579 [Nelumbo nucifera] Length = 41 Score = 75.9 bits (185), Expect = 1e-11 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +3 Query: 108 MSAVVSEILLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 230 MS ++SEILLSGF INSTLRRR+HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_009404012.1| PREDICTED: uncharacterized protein LOC103987431 [Musa acuminata subsp. malaccensis] Length = 41 Score = 75.9 bits (185), Expect = 1e-11 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = +3 Query: 108 MSAVVSEILLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 230 MSA++SEILLSGF I+STLRRR+HLVQSFSVVFLYWFYVFS Sbjct: 1 MSAILSEILLSGFMISSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_010254729.1| PREDICTED: uncharacterized protein LOC104595623 [Nelumbo nucifera] Length = 41 Score = 75.5 bits (184), Expect = 1e-11 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +3 Query: 108 MSAVVSEILLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 230 MS +VSEILLSGF INS+LRRR+HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPIVSEILLSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_006340664.1| PREDICTED: uncharacterized protein LOC102593404 [Solanum tuberosum] gi|723672381|ref|XP_010316390.1| PREDICTED: uncharacterized protein LOC104645744 [Solanum lycopersicum] Length = 41 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 108 MSAVVSEILLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 230 M+ V+SE+LLSGFTINSTLRR +HLVQSFSVVFLYWFYVFS Sbjct: 1 MTPVISEVLLSGFTINSTLRRGTHLVQSFSVVFLYWFYVFS 41 >ref|XP_009403897.1| PREDICTED: uncharacterized protein LOC103987344 [Musa acuminata subsp. malaccensis] Length = 41 Score = 74.7 bits (182), Expect = 2e-11 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 108 MSAVVSEILLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 230 M+ ++SEILLSGFTINSTLRRR+HLVQS SVVFLYWFYVFS Sbjct: 1 MTPILSEILLSGFTINSTLRRRTHLVQSLSVVFLYWFYVFS 41 >ref|XP_009386487.1| PREDICTED: uncharacterized protein LOC103973592 [Musa acuminata subsp. malaccensis] Length = 41 Score = 73.9 bits (180), Expect = 4e-11 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = +3 Query: 108 MSAVVSEILLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 230 MS V+SEIL SGF INSTLRRR+HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEILRSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_006585165.1| PREDICTED: uncharacterized protein LOC102669679 [Glycine max] gi|593792796|ref|XP_007159437.1| hypothetical protein PHAVU_002G237700g [Phaseolus vulgaris] gi|561032852|gb|ESW31431.1| hypothetical protein PHAVU_002G237700g [Phaseolus vulgaris] gi|947110612|gb|KRH58938.1| hypothetical protein GLYMA_05G157100 [Glycine max] Length = 42 Score = 73.9 bits (180), Expect = 4e-11 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = +3 Query: 111 SAVVSEILLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 230 S V+SEILLSGFTINS+LRRR+HLVQSFSVVFL+WFYVFS Sbjct: 3 SPVISEILLSGFTINSSLRRRTHLVQSFSVVFLHWFYVFS 42 >ref|XP_002276079.2| PREDICTED: uncharacterized protein LOC100247207 [Vitis vinifera] Length = 41 Score = 73.6 bits (179), Expect = 6e-11 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = +3 Query: 108 MSAVVSEILLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 230 MS V+SE+L SGF INSTLRRR+HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEVLRSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_009380389.1| PREDICTED: uncharacterized protein LOC103968797 [Musa acuminata subsp. malaccensis] Length = 41 Score = 73.6 bits (179), Expect = 6e-11 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = +3 Query: 108 MSAVVSEILLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 230 MS ++SEILL GF INSTLRRR+HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPILSEILLLGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_006473551.1| PREDICTED: uncharacterized protein LOC102624295 [Citrus sinensis] gi|590593628|ref|XP_007017623.1| Peptide upstream open reading frame 5 [Theobroma cacao] gi|508722951|gb|EOY14848.1| Peptide upstream open reading frame 5 [Theobroma cacao] Length = 41 Score = 73.6 bits (179), Expect = 6e-11 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = +3 Query: 108 MSAVVSEILLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 230 MS VVSEIL SGF INS+LRRR+HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVVSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_011028507.1| PREDICTED: uncharacterized protein LOC105128494 [Populus euphratica] Length = 41 Score = 73.2 bits (178), Expect = 7e-11 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = +3 Query: 108 MSAVVSEILLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 230 M+ V+ EILLSGF INSTLRRR+HLVQSFSVVFLYWFYVFS Sbjct: 1 MTPVLCEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_008452106.1| PREDICTED: uncharacterized protein LOC103493212 [Cucumis melo] Length = 41 Score = 72.8 bits (177), Expect = 9e-11 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = +3 Query: 108 MSAVVSEILLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 230 MS VVSEILLSGF INS LRRR+HLVQSFSVVFLYWFY FS Sbjct: 1 MSPVVSEILLSGFIINSALRRRTHLVQSFSVVFLYWFYNFS 41