BLASTX nr result
ID: Perilla23_contig00017494
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00017494 (647 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDP24548.1| hypothetical protein JCGZ_25112 [Jatropha curcas] 59 2e-06 >gb|KDP24548.1| hypothetical protein JCGZ_25112 [Jatropha curcas] Length = 56 Score = 59.3 bits (142), Expect = 2e-06 Identities = 26/48 (54%), Positives = 33/48 (68%), Gaps = 2/48 (4%) Frame = +2 Query: 509 MGYYEQWAQALASACGFILLIGLVCCCLSSKPRPHG--TNSSSTGACS 646 M +Y+ W QA+ASA G +LLIGL+CCCLS+KPR HG G C+ Sbjct: 1 MEHYKNWIQAIASAWGLMLLIGLMCCCLSTKPRQHGDVNGGGGIGGCT 48