BLASTX nr result
ID: Perilla23_contig00017423
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00017423 (455 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP15398.1| unnamed protein product [Coffea canephora] 92 1e-16 ref|XP_011094369.1| PREDICTED: zinc finger A20 and AN1 domain-co... 91 4e-16 ref|XP_010107862.1| Zinc finger A20 and AN1 domain-containing st... 83 7e-14 ref|XP_012839679.1| PREDICTED: zinc finger A20 and AN1 domain-co... 83 7e-14 ref|XP_004303001.1| PREDICTED: zinc finger A20 and AN1 domain-co... 82 2e-13 ref|XP_010271706.1| PREDICTED: zinc finger A20 and AN1 domain-co... 82 2e-13 gb|EPS60974.1| hypothetical protein M569_13826 [Genlisea aurea] 82 2e-13 ref|XP_012066479.1| PREDICTED: zinc finger A20 and AN1 domain-co... 81 3e-13 ref|XP_006339126.1| PREDICTED: zinc finger A20 and AN1 domain-co... 81 3e-13 gb|ACM68459.1| stress-associated protein 9 [Solanum pennellii] 81 3e-13 ref|XP_012441708.1| PREDICTED: zinc finger A20 and AN1 domain-co... 80 5e-13 ref|XP_010244455.1| PREDICTED: zinc finger A20 and AN1 domain-co... 80 5e-13 ref|XP_010101592.1| Zinc finger A20 and AN1 domain-containing st... 80 6e-13 ref|XP_009374741.1| PREDICTED: zinc finger A20 and AN1 domain-co... 80 6e-13 ref|XP_009366652.1| PREDICTED: zinc finger A20 and AN1 domain-co... 80 6e-13 ref|XP_008369706.1| PREDICTED: zinc finger A20 and AN1 domain-co... 80 6e-13 ref|XP_007027699.1| A20/AN1-like zinc finger family protein, put... 80 6e-13 ref|XP_008241258.1| PREDICTED: zinc finger A20 and AN1 domain-co... 80 8e-13 ref|XP_007202639.1| hypothetical protein PRUPE_ppa012097mg [Prun... 80 8e-13 ref|XP_007162885.1| hypothetical protein PHAVU_001G188800g [Phas... 79 1e-12 >emb|CDP15398.1| unnamed protein product [Coffea canephora] Length = 164 Score = 92.4 bits (228), Expect = 1e-16 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = -1 Query: 212 MAEEHGFQPQAPEGHRLCANNCGFFGSPATQNLCSKCYQDLCLKNSADSNS 60 MAEEHGF+ APEGHRLCANNCGFFGSPATQN CSKCY+DLCL ADS + Sbjct: 1 MAEEHGFR--APEGHRLCANNCGFFGSPATQNFCSKCYRDLCLNKEADSKA 49 >ref|XP_011094369.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 4 isoform X1 [Sesamum indicum] gi|747093151|ref|XP_011094370.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 4 isoform X2 [Sesamum indicum] Length = 160 Score = 90.5 bits (223), Expect = 4e-16 Identities = 44/60 (73%), Positives = 48/60 (80%), Gaps = 2/60 (3%) Frame = -1 Query: 212 MAEEHGFQPQAPEGHRLCANNCGFFGSPATQNLCSKCYQDLCLKNSAD--SNSLFPAQST 39 MAEEHGFQ APEGHRLC NNCGFFGSPATQN+CSKCY+DL +K SAD + S P ST Sbjct: 1 MAEEHGFQ--APEGHRLCVNNCGFFGSPATQNMCSKCYRDLSIKKSADFSTPSTAPPPST 58 >ref|XP_010107862.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 4 [Morus notabilis] gi|587930133|gb|EXC17262.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 4 [Morus notabilis] Length = 105 Score = 83.2 bits (204), Expect = 7e-14 Identities = 37/50 (74%), Positives = 41/50 (82%) Frame = -1 Query: 212 MAEEHGFQPQAPEGHRLCANNCGFFGSPATQNLCSKCYQDLCLKNSADSN 63 MAEEH + QAPEGHRLCANNCGFFGSPAT NLCSKCY+D CLK ++ Sbjct: 1 MAEEH--KCQAPEGHRLCANNCGFFGSPATMNLCSKCYRDFCLKEQQQAS 48 >ref|XP_012839679.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Erythranthe guttatus] gi|604330441|gb|EYU35469.1| hypothetical protein MIMGU_mgv1a022466mg [Erythranthe guttata] Length = 146 Score = 83.2 bits (204), Expect = 7e-14 Identities = 36/53 (67%), Positives = 41/53 (77%) Frame = -1 Query: 212 MAEEHGFQPQAPEGHRLCANNCGFFGSPATQNLCSKCYQDLCLKNSADSNSLF 54 MAEEHGF + GHRLC NNCGFFGS ATQN+CSKCY+D+ L SAD + LF Sbjct: 1 MAEEHGFDQASDGGHRLCVNNCGFFGSSATQNMCSKCYRDVSLHKSADPSPLF 53 >ref|XP_004303001.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like [Fragaria vesca subsp. vesca] Length = 171 Score = 82.0 bits (201), Expect = 2e-13 Identities = 36/50 (72%), Positives = 42/50 (84%) Frame = -1 Query: 212 MAEEHGFQPQAPEGHRLCANNCGFFGSPATQNLCSKCYQDLCLKNSADSN 63 MAEEH + QAPEGHRLCAN+CGFFGSPAT NLCSKCY+D CLK +++ Sbjct: 1 MAEEH--RCQAPEGHRLCANSCGFFGSPATMNLCSKCYRDFCLKEQQEAS 48 >ref|XP_010271706.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like [Nelumbo nucifera] Length = 173 Score = 81.6 bits (200), Expect = 2e-13 Identities = 37/51 (72%), Positives = 41/51 (80%) Frame = -1 Query: 212 MAEEHGFQPQAPEGHRLCANNCGFFGSPATQNLCSKCYQDLCLKNSADSNS 60 MAEEH +P PEGH LCANNCGFFGSPAT NLCSKCY+DLCLK S++ Sbjct: 1 MAEEHRCKP--PEGHHLCANNCGFFGSPATLNLCSKCYRDLCLKEEQASSA 49 >gb|EPS60974.1| hypothetical protein M569_13826 [Genlisea aurea] Length = 150 Score = 81.6 bits (200), Expect = 2e-13 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = -1 Query: 212 MAEEHGFQPQAPEGHRLCANNCGFFGSPATQNLCSKCYQDLCLKNSADSNSLFPAQS 42 MAEEHGFQ A +GHR+C NNCGF G+PA QNLCSKCY LCL+ S DS PA S Sbjct: 1 MAEEHGFQ--ATDGHRMCVNNCGFLGNPAKQNLCSKCYTVLCLEKSGDSPIFTPALS 55 >ref|XP_012066479.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 4-like [Jatropha curcas] gi|643736409|gb|KDP42728.1| hypothetical protein JCGZ_23668 [Jatropha curcas] Length = 159 Score = 81.3 bits (199), Expect = 3e-13 Identities = 37/44 (84%), Positives = 38/44 (86%) Frame = -1 Query: 212 MAEEHGFQPQAPEGHRLCANNCGFFGSPATQNLCSKCYQDLCLK 81 MAEEH + QAPEGHRLCANNCGFFGSPAT NLCSKCY D CLK Sbjct: 1 MAEEH--RCQAPEGHRLCANNCGFFGSPATMNLCSKCYGDYCLK 42 >ref|XP_006339126.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 4-like [Solanum tuberosum] Length = 159 Score = 80.9 bits (198), Expect = 3e-13 Identities = 38/58 (65%), Positives = 43/58 (74%), Gaps = 2/58 (3%) Frame = -1 Query: 212 MAEEHGFQPQAPEGHRLCANNCGFFGSPATQNLCSKCYQDLCLKNSADS--NSLFPAQ 45 MAEEHGF+ APEGH LCANNCGFFGSP TQN CSKCY ++ +K +SLFP Q Sbjct: 1 MAEEHGFE--APEGHILCANNCGFFGSPTTQNFCSKCYNEVYIKGGQQKPIDSLFPPQ 56 >gb|ACM68459.1| stress-associated protein 9 [Solanum pennellii] Length = 156 Score = 80.9 bits (198), Expect = 3e-13 Identities = 38/58 (65%), Positives = 43/58 (74%), Gaps = 2/58 (3%) Frame = -1 Query: 212 MAEEHGFQPQAPEGHRLCANNCGFFGSPATQNLCSKCYQDLCLKNSADS--NSLFPAQ 45 MAEEHGF+ APEGH LCANNCGFFGSP TQN CSKCY ++ +K +SLFP Q Sbjct: 1 MAEEHGFE--APEGHILCANNCGFFGSPTTQNFCSKCYNEVYIKGGLQKPIDSLFPPQ 56 >ref|XP_012441708.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like [Gossypium raimondii] gi|763795171|gb|KJB62167.1| hypothetical protein B456_009G404700 [Gossypium raimondii] Length = 161 Score = 80.5 bits (197), Expect = 5e-13 Identities = 37/50 (74%), Positives = 40/50 (80%) Frame = -1 Query: 212 MAEEHGFQPQAPEGHRLCANNCGFFGSPATQNLCSKCYQDLCLKNSADSN 63 MAEEH + QAPEGHRLC NNCGFFGS AT NLCSKCY+DLCLK S+ Sbjct: 1 MAEEH--RCQAPEGHRLCVNNCGFFGSSATMNLCSKCYRDLCLKEQEASS 48 >ref|XP_010244455.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 4-like [Nelumbo nucifera] gi|719974275|ref|XP_010244459.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 4-like [Nelumbo nucifera] Length = 168 Score = 80.5 bits (197), Expect = 5e-13 Identities = 38/59 (64%), Positives = 45/59 (76%) Frame = -1 Query: 212 MAEEHGFQPQAPEGHRLCANNCGFFGSPATQNLCSKCYQDLCLKNSADSNSLFPAQSTV 36 MAEEH + QAPEGHRLCANNCGFFGSPAT NLCSKCY+DL LK S++ + ++ Sbjct: 1 MAEEH--RCQAPEGHRLCANNCGFFGSPATLNLCSKCYRDLRLKEEQASSAKIAVEKSL 57 >ref|XP_010101592.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 4 [Morus notabilis] gi|587900416|gb|EXB88731.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 4 [Morus notabilis] Length = 169 Score = 80.1 bits (196), Expect = 6e-13 Identities = 36/50 (72%), Positives = 40/50 (80%) Frame = -1 Query: 212 MAEEHGFQPQAPEGHRLCANNCGFFGSPATQNLCSKCYQDLCLKNSADSN 63 MAEEH + QAPEGHRLCANNCGFFGS AT NLCSKCY+D CLK ++ Sbjct: 1 MAEEH--RCQAPEGHRLCANNCGFFGSSATMNLCSKCYRDFCLKEQQQAS 48 >ref|XP_009374741.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 4-like [Pyrus x bretschneideri] Length = 188 Score = 80.1 bits (196), Expect = 6e-13 Identities = 34/50 (68%), Positives = 41/50 (82%) Frame = -1 Query: 212 MAEEHGFQPQAPEGHRLCANNCGFFGSPATQNLCSKCYQDLCLKNSADSN 63 MAEEH + +APEGH LCANNCGFFGSPAT NLCSKCY+D C+K +++ Sbjct: 1 MAEEH--RCEAPEGHHLCANNCGFFGSPATMNLCSKCYRDFCIKEQQEAS 48 >ref|XP_009366652.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 4 [Pyrus x bretschneideri] Length = 189 Score = 80.1 bits (196), Expect = 6e-13 Identities = 35/50 (70%), Positives = 40/50 (80%) Frame = -1 Query: 212 MAEEHGFQPQAPEGHRLCANNCGFFGSPATQNLCSKCYQDLCLKNSADSN 63 MAEEH + +APEGH LCANNCGFFGSPAT NLCSKCY+D CLK ++ Sbjct: 1 MAEEH--RCEAPEGHHLCANNCGFFGSPATMNLCSKCYRDFCLKEQQQAS 48 >ref|XP_008369706.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 4 [Malus domestica] gi|658020053|ref|XP_008345402.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 4-like [Malus domestica] Length = 189 Score = 80.1 bits (196), Expect = 6e-13 Identities = 35/50 (70%), Positives = 40/50 (80%) Frame = -1 Query: 212 MAEEHGFQPQAPEGHRLCANNCGFFGSPATQNLCSKCYQDLCLKNSADSN 63 MAEEH + +APEGH LCANNCGFFGSPAT NLCSKCY+D CLK ++ Sbjct: 1 MAEEH--RCEAPEGHHLCANNCGFFGSPATMNLCSKCYRDFCLKEQQQAS 48 >ref|XP_007027699.1| A20/AN1-like zinc finger family protein, putative isoform 1 [Theobroma cacao] gi|590631933|ref|XP_007027700.1| A20/AN1-like zinc finger family protein, putative isoform 1 [Theobroma cacao] gi|508716304|gb|EOY08201.1| A20/AN1-like zinc finger family protein, putative isoform 1 [Theobroma cacao] gi|508716305|gb|EOY08202.1| A20/AN1-like zinc finger family protein, putative isoform 1 [Theobroma cacao] Length = 165 Score = 80.1 bits (196), Expect = 6e-13 Identities = 36/52 (69%), Positives = 42/52 (80%) Frame = -1 Query: 212 MAEEHGFQPQAPEGHRLCANNCGFFGSPATQNLCSKCYQDLCLKNSADSNSL 57 MAEEH + QAPEGHRLC NNCGFFGSPAT NLCSKCY+D LK +++S+ Sbjct: 1 MAEEH--RCQAPEGHRLCVNNCGFFGSPATMNLCSKCYRDFRLKEQQEASSI 50 >ref|XP_008241258.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like [Prunus mume] gi|645272154|ref|XP_008241259.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like [Prunus mume] Length = 183 Score = 79.7 bits (195), Expect = 8e-13 Identities = 36/50 (72%), Positives = 41/50 (82%) Frame = -1 Query: 212 MAEEHGFQPQAPEGHRLCANNCGFFGSPATQNLCSKCYQDLCLKNSADSN 63 MAEEH + QAPEG RLCANNCGFFGSPAT NLCSKCY+D CLK +++ Sbjct: 1 MAEEH--RCQAPEGLRLCANNCGFFGSPATMNLCSKCYRDFCLKEQQEAS 48 >ref|XP_007202639.1| hypothetical protein PRUPE_ppa012097mg [Prunus persica] gi|595807616|ref|XP_007202640.1| hypothetical protein PRUPE_ppa012097mg [Prunus persica] gi|462398170|gb|EMJ03838.1| hypothetical protein PRUPE_ppa012097mg [Prunus persica] gi|462398171|gb|EMJ03839.1| hypothetical protein PRUPE_ppa012097mg [Prunus persica] Length = 183 Score = 79.7 bits (195), Expect = 8e-13 Identities = 36/50 (72%), Positives = 41/50 (82%) Frame = -1 Query: 212 MAEEHGFQPQAPEGHRLCANNCGFFGSPATQNLCSKCYQDLCLKNSADSN 63 MAEEH + QAPEG RLCANNCGFFGSPAT NLCSKCY+D CLK +++ Sbjct: 1 MAEEH--RCQAPEGLRLCANNCGFFGSPATMNLCSKCYRDFCLKEQQEAS 48 >ref|XP_007162885.1| hypothetical protein PHAVU_001G188800g [Phaseolus vulgaris] gi|593799696|ref|XP_007162886.1| hypothetical protein PHAVU_001G188800g [Phaseolus vulgaris] gi|561036349|gb|ESW34879.1| hypothetical protein PHAVU_001G188800g [Phaseolus vulgaris] gi|561036350|gb|ESW34880.1| hypothetical protein PHAVU_001G188800g [Phaseolus vulgaris] Length = 162 Score = 79.3 bits (194), Expect = 1e-12 Identities = 36/51 (70%), Positives = 41/51 (80%) Frame = -1 Query: 212 MAEEHGFQPQAPEGHRLCANNCGFFGSPATQNLCSKCYQDLCLKNSADSNS 60 MAEEH + QAPEGHRLCANNCGFFGSPAT NLCSKCY+D+ LK + + Sbjct: 1 MAEEH--RCQAPEGHRLCANNCGFFGSPATMNLCSKCYRDIRLKEEEQAKT 49