BLASTX nr result
ID: Perilla23_contig00017289
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00017289 (324 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012853432.1| PREDICTED: lysM domain-containing GPI-anchor... 71 3e-10 ref|XP_011074853.1| PREDICTED: lysM domain-containing GPI-anchor... 66 9e-09 ref|XP_011069550.1| PREDICTED: lysM domain-containing GPI-anchor... 65 2e-08 >ref|XP_012853432.1| PREDICTED: lysM domain-containing GPI-anchored protein 1 [Erythranthe guttatus] gi|604304641|gb|EYU23892.1| hypothetical protein MIMGU_mgv1a007097mg [Erythranthe guttata] Length = 419 Score = 71.2 bits (173), Expect = 3e-10 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = -1 Query: 105 SVGAFLPRAAPKSTIEPCSNADSCSALVGYTLYTD 1 ++GAFLPRAAPKSTIEPCSN+D+CSALVGYTLYTD Sbjct: 15 TIGAFLPRAAPKSTIEPCSNSDTCSALVGYTLYTD 49 >ref|XP_011074853.1| PREDICTED: lysM domain-containing GPI-anchored protein 1 [Sesamum indicum] Length = 422 Score = 66.2 bits (160), Expect = 9e-09 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = -1 Query: 105 SVGAFLPRAAPKSTIEPCSNADSCSALVGYTLYTD 1 ++GAFLPRAA KSTIEPCSN+D+CS+LVGYTLYTD Sbjct: 15 TLGAFLPRAASKSTIEPCSNSDTCSSLVGYTLYTD 49 >ref|XP_011069550.1| PREDICTED: lysM domain-containing GPI-anchored protein 1 [Sesamum indicum] Length = 417 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -1 Query: 102 VGAFLPRAAPKSTIEPCSNADSCSALVGYTLYTD 1 +GA LPRA PKSTIEPCSN+DSC++LVGYTLYTD Sbjct: 17 LGALLPRATPKSTIEPCSNSDSCTSLVGYTLYTD 50