BLASTX nr result
ID: Perilla23_contig00017149
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00017149 (348 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011096456.1| PREDICTED: uncharacterized protein At4g06598... 63 1e-07 >ref|XP_011096456.1| PREDICTED: uncharacterized protein At4g06598-like [Sesamum indicum] Length = 394 Score = 62.8 bits (151), Expect = 1e-07 Identities = 36/90 (40%), Positives = 57/90 (63%), Gaps = 10/90 (11%) Frame = +2 Query: 2 DDLLNDSGSLFHRSGHQRSASDSFAYLGAAA-----TDESEFVNAYF-----AQHLTKSK 151 DDLLN+S +L HR H+RSASDS+AYLG AA ++E ++VNA +Q+L K Sbjct: 124 DDLLNESETLIHRGHHRRSASDSYAYLGEAAETLNISEEPKYVNANVGTSTRSQNLLHYK 183 Query: 152 DLDNTFSQTKESGDQVASSQKVDEAANKAA 241 D+D+ ++TK + ++Q+++E + A Sbjct: 184 DVDSNSTETKTNSLAEKNNQELEEVVSTLA 213