BLASTX nr result
ID: Perilla23_contig00015362
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00015362 (562 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011077444.1| PREDICTED: uncharacterized protein LOC105161... 74 4e-11 >ref|XP_011077444.1| PREDICTED: uncharacterized protein LOC105161450 [Sesamum indicum] Length = 43 Score = 74.3 bits (181), Expect = 4e-11 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +3 Query: 228 MHSVPSNDLLLFTRPHVTSFYGGSSFHRLKHLQKSDRRGNL 350 MHSVPS+ LLL TRPHVTSFYGG S HRLKHL KSDRRGNL Sbjct: 1 MHSVPSSHLLLLTRPHVTSFYGGWSSHRLKHLHKSDRRGNL 41