BLASTX nr result
ID: Perilla23_contig00015043
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00015043 (388 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011099844.1| PREDICTED: 26S proteasome non-ATPase regulat... 75 1e-11 ref|XP_012845802.1| PREDICTED: 26S proteasome non-ATPase regulat... 75 2e-11 ref|XP_012845047.1| PREDICTED: 26S proteasome non-ATPase regulat... 74 4e-11 ref|XP_012845046.1| PREDICTED: 26S proteasome non-ATPase regulat... 74 4e-11 ref|XP_011099843.1| PREDICTED: 26S proteasome non-ATPase regulat... 73 7e-11 emb|CDP01880.1| unnamed protein product [Coffea canephora] 72 2e-10 ref|XP_014519217.1| PREDICTED: 26S proteasome non-ATPase regulat... 72 2e-10 ref|XP_014519216.1| PREDICTED: 26S proteasome non-ATPase regulat... 72 2e-10 ref|XP_014519215.1| PREDICTED: 26S proteasome non-ATPase regulat... 72 2e-10 ref|XP_014519213.1| PREDICTED: 26S proteasome non-ATPase regulat... 72 2e-10 ref|XP_014509036.1| PREDICTED: 26S proteasome non-ATPase regulat... 72 2e-10 gb|KRH76644.1| hypothetical protein GLYMA_01G165100 [Glycine max] 72 2e-10 gb|KRH76643.1| hypothetical protein GLYMA_01G165100 [Glycine max] 72 2e-10 gb|KRH69765.1| hypothetical protein GLYMA_02G046900 [Glycine max] 72 2e-10 gb|KRH28809.1| hypothetical protein GLYMA_11G078100 [Glycine max] 72 2e-10 gb|KOM32203.1| hypothetical protein LR48_Vigan01g175900 [Vigna a... 72 2e-10 gb|KOM28078.1| hypothetical protein LR48_Vigan499s002200, partia... 72 2e-10 ref|XP_011099866.1| PREDICTED: 26S proteasome non-ATPase regulat... 72 2e-10 gb|KHN41889.1| 26S proteasome non-ATPase regulatory subunit 4 [G... 72 2e-10 gb|KHN36023.1| 26S proteasome non-ATPase regulatory subunit 4 [G... 72 2e-10 >ref|XP_011099844.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog isoform X2 [Sesamum indicum] Length = 402 Score = 75.5 bits (184), Expect = 1e-11 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -2 Query: 387 LLADQSFVSSILASLPGVDPNDPHVKDLLASMQNQSEN 274 LLADQSFVSSILASLPGVDPNDPHVKDLLASMQ+QSEN Sbjct: 352 LLADQSFVSSILASLPGVDPNDPHVKDLLASMQSQSEN 389 >ref|XP_012845802.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog [Erythranthe guttatus] gi|848891372|ref|XP_012845803.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog [Erythranthe guttatus] gi|604319056|gb|EYU30416.1| hypothetical protein MIMGU_mgv1a007848mg [Erythranthe guttata] gi|604319057|gb|EYU30417.1| hypothetical protein MIMGU_mgv1a007848mg [Erythranthe guttata] Length = 393 Score = 75.1 bits (183), Expect = 2e-11 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 387 LLADQSFVSSILASLPGVDPNDPHVKDLLASMQNQSE 277 LLADQSFVSSILASLPGVDPNDPHVKDLLASMQNQSE Sbjct: 343 LLADQSFVSSILASLPGVDPNDPHVKDLLASMQNQSE 379 >ref|XP_012845047.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog isoform X2 [Erythranthe guttatus] gi|604319628|gb|EYU30792.1| hypothetical protein MIMGU_mgv1a007763mg [Erythranthe guttata] gi|604319629|gb|EYU30793.1| hypothetical protein MIMGU_mgv1a007763mg [Erythranthe guttata] Length = 395 Score = 73.9 bits (180), Expect = 4e-11 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 387 LLADQSFVSSILASLPGVDPNDPHVKDLLASMQNQSE 277 LLADQSF+SSILASLPGVDPNDPHVKDLLASMQNQSE Sbjct: 345 LLADQSFMSSILASLPGVDPNDPHVKDLLASMQNQSE 381 >ref|XP_012845046.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog isoform X1 [Erythranthe guttatus] gi|604319627|gb|EYU30791.1| hypothetical protein MIMGU_mgv1a007763mg [Erythranthe guttata] Length = 396 Score = 73.9 bits (180), Expect = 4e-11 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 387 LLADQSFVSSILASLPGVDPNDPHVKDLLASMQNQSE 277 LLADQSF+SSILASLPGVDPNDPHVKDLLASMQNQSE Sbjct: 345 LLADQSFMSSILASLPGVDPNDPHVKDLLASMQNQSE 381 >ref|XP_011099843.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog isoform X1 [Sesamum indicum] Length = 403 Score = 73.2 bits (178), Expect = 7e-11 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 387 LLADQSFVSSILASLPGVDPNDPHVKDLLASMQNQSE 277 LLADQSFVSSILASLPGVDPNDPHVKDLLASMQ+QSE Sbjct: 352 LLADQSFVSSILASLPGVDPNDPHVKDLLASMQSQSE 388 >emb|CDP01880.1| unnamed protein product [Coffea canephora] Length = 401 Score = 72.0 bits (175), Expect = 2e-10 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -2 Query: 387 LLADQSFVSSILASLPGVDPNDPHVKDLLASMQNQSEN 274 LLADQSFVSSILASLPGVDPNDP VKDLLASMQNQSE+ Sbjct: 350 LLADQSFVSSILASLPGVDPNDPSVKDLLASMQNQSEH 387 >ref|XP_014519217.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog isoform X4 [Vigna radiata var. radiata] Length = 397 Score = 71.6 bits (174), Expect = 2e-10 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -2 Query: 387 LLADQSFVSSILASLPGVDPNDPHVKDLLASMQNQSE 277 LLADQSFVSSILASLPGVDPNDP VKDLLASMQNQSE Sbjct: 345 LLADQSFVSSILASLPGVDPNDPSVKDLLASMQNQSE 381 >ref|XP_014519216.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog isoform X3 [Vigna radiata var. radiata] Length = 403 Score = 71.6 bits (174), Expect = 2e-10 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -2 Query: 387 LLADQSFVSSILASLPGVDPNDPHVKDLLASMQNQSE 277 LLADQSFVSSILASLPGVDPNDP VKDLLASMQNQSE Sbjct: 351 LLADQSFVSSILASLPGVDPNDPSVKDLLASMQNQSE 387 >ref|XP_014519215.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog isoform X2 [Vigna radiata var. radiata] Length = 404 Score = 71.6 bits (174), Expect = 2e-10 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -2 Query: 387 LLADQSFVSSILASLPGVDPNDPHVKDLLASMQNQSE 277 LLADQSFVSSILASLPGVDPNDP VKDLLASMQNQSE Sbjct: 352 LLADQSFVSSILASLPGVDPNDPSVKDLLASMQNQSE 388 >ref|XP_014519213.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog isoform X1 [Vigna radiata var. radiata] Length = 405 Score = 71.6 bits (174), Expect = 2e-10 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -2 Query: 387 LLADQSFVSSILASLPGVDPNDPHVKDLLASMQNQSE 277 LLADQSFVSSILASLPGVDPNDP VKDLLASMQNQSE Sbjct: 353 LLADQSFVSSILASLPGVDPNDPSVKDLLASMQNQSE 389 >ref|XP_014509036.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog [Vigna radiata var. radiata] Length = 405 Score = 71.6 bits (174), Expect = 2e-10 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -2 Query: 387 LLADQSFVSSILASLPGVDPNDPHVKDLLASMQNQSE 277 LLADQSFVSSILASLPGVDPNDP VKDLLASMQNQSE Sbjct: 353 LLADQSFVSSILASLPGVDPNDPSVKDLLASMQNQSE 389 >gb|KRH76644.1| hypothetical protein GLYMA_01G165100 [Glycine max] Length = 321 Score = 71.6 bits (174), Expect = 2e-10 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -2 Query: 387 LLADQSFVSSILASLPGVDPNDPHVKDLLASMQNQSE 277 LLADQSFVSSILASLPGVDPNDP VKDLLASMQNQSE Sbjct: 269 LLADQSFVSSILASLPGVDPNDPSVKDLLASMQNQSE 305 >gb|KRH76643.1| hypothetical protein GLYMA_01G165100 [Glycine max] Length = 399 Score = 71.6 bits (174), Expect = 2e-10 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -2 Query: 387 LLADQSFVSSILASLPGVDPNDPHVKDLLASMQNQSE 277 LLADQSFVSSILASLPGVDPNDP VKDLLASMQNQSE Sbjct: 347 LLADQSFVSSILASLPGVDPNDPSVKDLLASMQNQSE 383 >gb|KRH69765.1| hypothetical protein GLYMA_02G046900 [Glycine max] Length = 403 Score = 71.6 bits (174), Expect = 2e-10 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -2 Query: 387 LLADQSFVSSILASLPGVDPNDPHVKDLLASMQNQSE 277 LLADQSFVSSILASLPGVDPNDP VKDLLASMQNQSE Sbjct: 351 LLADQSFVSSILASLPGVDPNDPSVKDLLASMQNQSE 387 >gb|KRH28809.1| hypothetical protein GLYMA_11G078100 [Glycine max] Length = 405 Score = 71.6 bits (174), Expect = 2e-10 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -2 Query: 387 LLADQSFVSSILASLPGVDPNDPHVKDLLASMQNQSE 277 LLADQSFVSSILASLPGVDPNDP VKDLLASMQNQSE Sbjct: 353 LLADQSFVSSILASLPGVDPNDPSVKDLLASMQNQSE 389 >gb|KOM32203.1| hypothetical protein LR48_Vigan01g175900 [Vigna angularis] Length = 405 Score = 71.6 bits (174), Expect = 2e-10 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -2 Query: 387 LLADQSFVSSILASLPGVDPNDPHVKDLLASMQNQSE 277 LLADQSFVSSILASLPGVDPNDP VKDLLASMQNQSE Sbjct: 353 LLADQSFVSSILASLPGVDPNDPSVKDLLASMQNQSE 389 >gb|KOM28078.1| hypothetical protein LR48_Vigan499s002200, partial [Vigna angularis] Length = 406 Score = 71.6 bits (174), Expect = 2e-10 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -2 Query: 387 LLADQSFVSSILASLPGVDPNDPHVKDLLASMQNQSE 277 LLADQSFVSSILASLPGVDPNDP VKDLLASMQNQSE Sbjct: 358 LLADQSFVSSILASLPGVDPNDPSVKDLLASMQNQSE 394 >ref|XP_011099866.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog [Sesamum indicum] gi|747103357|ref|XP_011099867.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog [Sesamum indicum] Length = 403 Score = 71.6 bits (174), Expect = 2e-10 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 387 LLADQSFVSSILASLPGVDPNDPHVKDLLASMQNQSE 277 LLADQSFVSSIL SLPGVDPNDPHVKDLLASMQ+QSE Sbjct: 352 LLADQSFVSSILTSLPGVDPNDPHVKDLLASMQSQSE 388 >gb|KHN41889.1| 26S proteasome non-ATPase regulatory subunit 4 [Glycine soja] Length = 307 Score = 71.6 bits (174), Expect = 2e-10 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -2 Query: 387 LLADQSFVSSILASLPGVDPNDPHVKDLLASMQNQSE 277 LLADQSFVSSILASLPGVDPNDP VKDLLASMQNQSE Sbjct: 255 LLADQSFVSSILASLPGVDPNDPSVKDLLASMQNQSE 291 >gb|KHN36023.1| 26S proteasome non-ATPase regulatory subunit 4 [Glycine soja] Length = 406 Score = 71.6 bits (174), Expect = 2e-10 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -2 Query: 387 LLADQSFVSSILASLPGVDPNDPHVKDLLASMQNQSE 277 LLADQSFVSSILASLPGVDPNDP VKDLLASMQNQSE Sbjct: 354 LLADQSFVSSILASLPGVDPNDPSVKDLLASMQNQSE 390