BLASTX nr result
ID: Perilla23_contig00013848
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00013848 (296 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011073264.1| PREDICTED: inositol polyphosphate multikinas... 57 5e-06 >ref|XP_011073264.1| PREDICTED: inositol polyphosphate multikinase alpha [Sesamum indicum] gi|747054142|ref|XP_011073265.1| PREDICTED: inositol polyphosphate multikinase alpha [Sesamum indicum] gi|747054144|ref|XP_011073266.1| PREDICTED: inositol polyphosphate multikinase alpha [Sesamum indicum] Length = 301 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = -2 Query: 295 LCSFIKFISEILTTPEDCAADSVLQDAQRNHIYSDNGS 182 LCS IKFISEILTTPED + + +L+D R+H+Y +NGS Sbjct: 263 LCSLIKFISEILTTPEDSSTNGLLEDVHRSHVYPENGS 300