BLASTX nr result
ID: Perilla23_contig00013655
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00013655 (324 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011070499.1| PREDICTED: cell division cycle and apoptosis... 61 3e-07 ref|XP_011070498.1| PREDICTED: cell division cycle and apoptosis... 61 3e-07 >ref|XP_011070499.1| PREDICTED: cell division cycle and apoptosis regulator protein 1 isoform X2 [Sesamum indicum] Length = 1359 Score = 61.2 bits (147), Expect = 3e-07 Identities = 37/84 (44%), Positives = 48/84 (57%), Gaps = 4/84 (4%) Frame = -1 Query: 297 KIELVKAGMMKVELQRKEESPSLGHPGNDNRXXXXXXXXXXXXKLVSQEGKEKDKPVENK 118 K E +K K ELQ+K+ES S G G+DN+ LVS EGKEKDK V +K Sbjct: 724 KPEHLKDSAGKSELQKKKESTSSGQSGDDNKKDKSIKQLKASGNLVSDEGKEKDKAVGDK 783 Query: 117 DVVGSTEDAKNVT----GGGSSDQ 58 +VGST++ +NV GG S+ Q Sbjct: 784 GMVGSTDEERNVVKTGQGGNSAAQ 807 >ref|XP_011070498.1| PREDICTED: cell division cycle and apoptosis regulator protein 1 isoform X1 [Sesamum indicum] Length = 1363 Score = 61.2 bits (147), Expect = 3e-07 Identities = 37/84 (44%), Positives = 48/84 (57%), Gaps = 4/84 (4%) Frame = -1 Query: 297 KIELVKAGMMKVELQRKEESPSLGHPGNDNRXXXXXXXXXXXXKLVSQEGKEKDKPVENK 118 K E +K K ELQ+K+ES S G G+DN+ LVS EGKEKDK V +K Sbjct: 728 KPEHLKDSAGKSELQKKKESTSSGQSGDDNKKDKSIKQLKASGNLVSDEGKEKDKAVGDK 787 Query: 117 DVVGSTEDAKNVT----GGGSSDQ 58 +VGST++ +NV GG S+ Q Sbjct: 788 GMVGSTDEERNVVKTGQGGNSAAQ 811