BLASTX nr result
ID: Perilla23_contig00013523
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00013523 (521 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011087804.1| PREDICTED: pentatricopeptide repeat-containi... 113 6e-23 ref|XP_012828447.1| PREDICTED: pentatricopeptide repeat-containi... 89 1e-15 ref|XP_006351831.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-10 ref|XP_004230611.1| PREDICTED: pentatricopeptide repeat-containi... 70 6e-10 ref|XP_009783824.1| PREDICTED: pentatricopeptide repeat-containi... 67 7e-09 ref|XP_009615517.1| PREDICTED: pentatricopeptide repeat-containi... 65 3e-08 >ref|XP_011087804.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 [Sesamum indicum] gi|747081065|ref|XP_011087805.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 [Sesamum indicum] gi|747081067|ref|XP_011087806.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 [Sesamum indicum] gi|747081069|ref|XP_011087807.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 [Sesamum indicum] gi|747081071|ref|XP_011087808.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 [Sesamum indicum] gi|747081073|ref|XP_011087809.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 [Sesamum indicum] gi|747081075|ref|XP_011087810.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 [Sesamum indicum] Length = 552 Score = 113 bits (282), Expect = 6e-23 Identities = 50/88 (56%), Positives = 67/88 (76%) Frame = -3 Query: 264 RMEFWHQRAVIPKVLSTGFFHGQARTESPNSSASSTQWFVKVVSTLCIRHPHALAIFNSD 85 RM+FW QR I KV ST HG AR ES +SS +S WF+KVV TLC+ H H+L F++D Sbjct: 2 RMQFWAQRVSISKVFSTALLHGHARIESSHSSPASIVWFIKVVCTLCVHHSHSLNFFDTD 61 Query: 84 YFRNNLDPFVAYGVIYLLNSRLDDPNLA 1 YFR +L+PFVA+GV+Y +N+RL++P+LA Sbjct: 62 YFRESLNPFVAFGVVYHINNRLNNPDLA 89 >ref|XP_012828447.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 [Erythranthe guttatus] gi|848930449|ref|XP_012828448.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 [Erythranthe guttatus] gi|604298483|gb|EYU18527.1| hypothetical protein MIMGU_mgv1a003955mg [Erythranthe guttata] Length = 552 Score = 89.4 bits (220), Expect = 1e-15 Identities = 48/92 (52%), Positives = 61/92 (66%), Gaps = 5/92 (5%) Frame = -3 Query: 261 MEFWHQRAVIPKVLSTGFFHGQA---RTESPNS--SASSTQWFVKVVSTLCIRHPHALAI 97 M+FW R I KV FHG++ + SP S S SST WFVKVV TLCIR +LA Sbjct: 1 MQFWAPRVPISKVFLASLFHGRSSLVESSSPPSPSSPSSTFWFVKVVCTLCIRRSPSLAF 60 Query: 96 FNSDYFRNNLDPFVAYGVIYLLNSRLDDPNLA 1 +DYFR NL+P VA+ V+Y +NSRL++P+LA Sbjct: 61 VETDYFRVNLNPSVAFAVVYHINSRLNNPDLA 92 >ref|XP_006351831.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like isoform X1 [Solanum tuberosum] gi|565370447|ref|XP_006351832.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like isoform X2 [Solanum tuberosum] Length = 550 Score = 72.0 bits (175), Expect = 2e-10 Identities = 38/89 (42%), Positives = 51/89 (57%), Gaps = 2/89 (2%) Frame = -3 Query: 261 MEFWHQRAVIPKVLSTGFFHGQARTESPNSSASSTQ--WFVKVVSTLCIRHPHALAIFNS 88 M W QRA +L FHG ++S S + WF KVV LC H +L +F S Sbjct: 1 MPLWVQRA--SNILLIARFHGLTSSKSIPSYGPGPEAVWFTKVVCLLCFHHSQSLDVFGS 58 Query: 87 DYFRNNLDPFVAYGVIYLLNSRLDDPNLA 1 DYFR NLDP +A+ VI+ +N+ L++P LA Sbjct: 59 DYFRQNLDPHIAFTVIHHINTNLNNPRLA 87 >ref|XP_004230611.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 [Solanum lycopersicum] gi|723664227|ref|XP_010315007.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 [Solanum lycopersicum] Length = 550 Score = 70.1 bits (170), Expect = 6e-10 Identities = 37/89 (41%), Positives = 52/89 (58%), Gaps = 2/89 (2%) Frame = -3 Query: 261 MEFWHQRAVIPKVLSTGFFHGQARTESPNSSASSTQ--WFVKVVSTLCIRHPHALAIFNS 88 M W QRA +++ FHG ++S S + WF KVV LC H +L +F S Sbjct: 1 MPLWVQRASNISLIAR--FHGLTSSKSIPSYGPGPEAVWFTKVVCLLCFHHSQSLDVFGS 58 Query: 87 DYFRNNLDPFVAYGVIYLLNSRLDDPNLA 1 DYFR NLDP +A+ VI+ +N+ L++P LA Sbjct: 59 DYFRQNLDPHIAFTVIHHINTNLNNPRLA 87 >ref|XP_009783824.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 [Nicotiana sylvestris] gi|698470503|ref|XP_009783825.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 [Nicotiana sylvestris] gi|698470507|ref|XP_009783826.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 [Nicotiana sylvestris] gi|698470511|ref|XP_009783827.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 [Nicotiana sylvestris] Length = 546 Score = 66.6 bits (161), Expect = 7e-09 Identities = 35/87 (40%), Positives = 48/87 (55%) Frame = -3 Query: 261 MEFWHQRAVIPKVLSTGFFHGQARTESPNSSASSTQWFVKVVSTLCIRHPHALAIFNSDY 82 M W QR + + FH ++S S WF KVV LC H +L +F SDY Sbjct: 1 MPLWVQR--VSNISLIARFH---TSKSLPSYGPEAIWFTKVVCLLCFHHSQSLDVFTSDY 55 Query: 81 FRNNLDPFVAYGVIYLLNSRLDDPNLA 1 FR NLDP +A+ VI+ +N+ L++P LA Sbjct: 56 FRQNLDPHIAFNVIHHINTNLNNPRLA 82 >ref|XP_009615517.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 [Nicotiana tomentosiformis] gi|697123061|ref|XP_009615518.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 [Nicotiana tomentosiformis] gi|697123063|ref|XP_009615519.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 [Nicotiana tomentosiformis] gi|697123065|ref|XP_009615520.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 [Nicotiana tomentosiformis] gi|697123067|ref|XP_009615521.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 [Nicotiana tomentosiformis] Length = 546 Score = 64.7 bits (156), Expect = 3e-08 Identities = 35/87 (40%), Positives = 49/87 (56%) Frame = -3 Query: 261 MEFWHQRAVIPKVLSTGFFHGQARTESPNSSASSTQWFVKVVSTLCIRHPHALAIFNSDY 82 M W QRA +++ FH ++S S WF KVV LC H +L +F SD+ Sbjct: 1 MPLWVQRASNISLIAR--FH---TSKSLPSYGPEAIWFTKVVCLLCFHHSQSLDVFTSDF 55 Query: 81 FRNNLDPFVAYGVIYLLNSRLDDPNLA 1 FR NLDP +A+ VI+ +N+ L +P LA Sbjct: 56 FRQNLDPHIAFNVIHHINTNLRNPRLA 82