BLASTX nr result
ID: Perilla23_contig00012685
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00012685 (377 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012857234.1| PREDICTED: uncharacterized protein LOC105976... 68 3e-09 ref|XP_007203109.1| hypothetical protein PRUPE_ppa023846mg [Prun... 57 5e-06 >ref|XP_012857234.1| PREDICTED: uncharacterized protein LOC105976546 [Erythranthe guttatus] gi|604301157|gb|EYU20877.1| hypothetical protein MIMGU_mgv1a017313mg [Erythranthe guttata] Length = 82 Score = 67.8 bits (164), Expect = 3e-09 Identities = 36/63 (57%), Positives = 43/63 (68%) Frame = -1 Query: 266 PVSRTFKTFKNQALFGSFNSQVLFKHGLQDVKEIENIVERRMSIELTDYPGTGANHNHDP 87 P+SR+ KTF+NQ S F + QDVK +E +VE RM +EL DYPGTGANHNHDP Sbjct: 27 PISRSLKTFQNQV------SVTYFPY--QDVK-MEKLVEGRMEMELADYPGTGANHNHDP 77 Query: 86 RPP 78 PP Sbjct: 78 TPP 80 >ref|XP_007203109.1| hypothetical protein PRUPE_ppa023846mg [Prunus persica] gi|462398640|gb|EMJ04308.1| hypothetical protein PRUPE_ppa023846mg [Prunus persica] Length = 90 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = -1 Query: 188 GLQDVKEIENIVERRMSIELTDYPGTGANHNHDPRPPGKS 69 GL DV E E +E RM +E TDYPGTGAN++HDPR PG++ Sbjct: 51 GLFDVGEGEGFIEGRMDMESTDYPGTGANNHHDPRTPGRA 90