BLASTX nr result
ID: Perilla23_contig00011494
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00011494 (332 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012852726.1| PREDICTED: dnaJ homolog subfamily A member 2... 57 5e-06 ref|XP_011081933.1| PREDICTED: dnaJ homolog 1, mitochondrial [Se... 57 7e-06 >ref|XP_012852726.1| PREDICTED: dnaJ homolog subfamily A member 2 [Erythranthe guttatus] gi|604305486|gb|EYU24630.1| hypothetical protein MIMGU_mgv1a004938mg [Erythranthe guttata] Length = 503 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 109 CFFTGGAPMWGSKKFLQVSVSSAAQSNKKISARRF 5 C FTGG+ +WGSKKFLQVS+SSAAQ +KK+ ARRF Sbjct: 40 CLFTGGSLIWGSKKFLQVSLSSAAQLDKKMCARRF 74 >ref|XP_011081933.1| PREDICTED: dnaJ homolog 1, mitochondrial [Sesamum indicum] Length = 499 Score = 56.6 bits (135), Expect = 7e-06 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = -2 Query: 109 CFFTGGAPMWGSKKFLQVSVSSAAQSNKKISARRFG 2 CF GG P+WG++KFL+VS+SSA Q NKK++ARRFG Sbjct: 36 CFSAGGDPVWGNRKFLRVSLSSATQLNKKMAARRFG 71