BLASTX nr result
ID: Perilla23_contig00010943
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00010943 (423 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012840975.1| PREDICTED: LOB domain-containing protein 41-... 75 1e-11 ref|XP_011099556.1| PREDICTED: LOB domain-containing protein 41 ... 73 7e-11 ref|XP_012856807.1| PREDICTED: LOB domain-containing protein 41 ... 65 2e-08 ref|XP_011097193.1| PREDICTED: LOB domain-containing protein 41-... 64 3e-08 >ref|XP_012840975.1| PREDICTED: LOB domain-containing protein 41-like [Erythranthe guttatus] gi|604329004|gb|EYU34399.1| hypothetical protein MIMGU_mgv1a011498mg [Erythranthe guttata] Length = 279 Score = 75.5 bits (184), Expect = 1e-11 Identities = 41/67 (61%), Positives = 49/67 (73%), Gaps = 1/67 (1%) Frame = -2 Query: 416 QEAGAAEMNLNSESEERQTSGEDEIELDLTLGFEPIKRCLKPKKLKLNEAD-DSAGFCKM 240 + G+AE +E E +T ++EIELDLTLGFEPIKRC KPK+LK +EA SAG C M Sbjct: 212 ESLGSAE---TAEPEADRTDDDEEIELDLTLGFEPIKRCPKPKELKPSEAGCKSAGVCGM 268 Query: 239 ELGLDYP 219 ELGLDYP Sbjct: 269 ELGLDYP 275 >ref|XP_011099556.1| PREDICTED: LOB domain-containing protein 41 [Sesamum indicum] Length = 282 Score = 73.2 bits (178), Expect = 7e-11 Identities = 39/70 (55%), Positives = 48/70 (68%), Gaps = 4/70 (5%) Frame = -2 Query: 410 AGAAEMNLNSESEERQTSGEDEIELDLTLGFEPIKRCLKPKKLKLNEA----DDSAGFCK 243 A AE L+S ++ + + + EIEL+LTLGFEP KR +KPK L EA +D AG CK Sbjct: 213 AEIAEQVLDSAVQDERRADDGEIELELTLGFEPFKRDVKPKVLATKEAVGSVEDDAGLCK 272 Query: 242 MELGLDYPAS 213 MELGLDYPAS Sbjct: 273 MELGLDYPAS 282 >ref|XP_012856807.1| PREDICTED: LOB domain-containing protein 41 [Erythranthe guttatus] gi|604346142|gb|EYU44639.1| hypothetical protein MIMGU_mgv1a011451mg [Erythranthe guttata] Length = 281 Score = 65.5 bits (158), Expect = 2e-08 Identities = 37/80 (46%), Positives = 48/80 (60%), Gaps = 14/80 (17%) Frame = -2 Query: 422 ADQEAGAAEMNLNSESEERQTSG------------EDEIELDLTLGFEPIKRCLKPKKLK 279 +++ A AAE N+ E R++ E EIELDLTLGFEP KR +KPK++ Sbjct: 192 SEEAAAAAETNVGIEDTARESESLASAACESASEDEGEIELDLTLGFEPFKRAVKPKEVA 251 Query: 278 LNEADD--SAGFCKMELGLD 225 + EA+D AG CKMEL LD Sbjct: 252 VKEAEDDGGAGLCKMELRLD 271 >ref|XP_011097193.1| PREDICTED: LOB domain-containing protein 41-like [Sesamum indicum] Length = 270 Score = 64.3 bits (155), Expect = 3e-08 Identities = 34/70 (48%), Positives = 46/70 (65%) Frame = -2 Query: 422 ADQEAGAAEMNLNSESEERQTSGEDEIELDLTLGFEPIKRCLKPKKLKLNEADDSAGFCK 243 AD G E N N++ + + +DEIELDLTLG EP+KR KPK+ + ++ D+ G CK Sbjct: 205 ADHGVGV-EPNFNTD---HRLANDDEIELDLTLGLEPMKRSPKPKRRQAGDSADNGGLCK 260 Query: 242 MELGLDYPAS 213 MEL L+ PAS Sbjct: 261 MELALECPAS 270