BLASTX nr result
ID: Perilla23_contig00010942
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00010942 (422 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011099556.1| PREDICTED: LOB domain-containing protein 41 ... 75 3e-11 ref|XP_012840975.1| PREDICTED: LOB domain-containing protein 41-... 73 1e-10 ref|XP_012856807.1| PREDICTED: LOB domain-containing protein 41 ... 67 7e-09 ref|XP_011097193.1| PREDICTED: LOB domain-containing protein 41-... 61 4e-07 >ref|XP_011099556.1| PREDICTED: LOB domain-containing protein 41 [Sesamum indicum] Length = 282 Score = 74.7 bits (182), Expect = 3e-11 Identities = 40/70 (57%), Positives = 48/70 (68%), Gaps = 4/70 (5%) Frame = -2 Query: 409 AGAAEMNLNSESEERLTSGEGEIELDLTLGFEPIKRCLKPKKLKLNEA----DDSAGFCK 242 A AE L+S ++ + +GEIEL+LTLGFEP KR +KPK L EA +D AG CK Sbjct: 213 AEIAEQVLDSAVQDERRADDGEIELELTLGFEPFKRDVKPKVLATKEAVGSVEDDAGLCK 272 Query: 241 MELGLDYPAS 212 MELGLDYPAS Sbjct: 273 MELGLDYPAS 282 >ref|XP_012840975.1| PREDICTED: LOB domain-containing protein 41-like [Erythranthe guttatus] gi|604329004|gb|EYU34399.1| hypothetical protein MIMGU_mgv1a011498mg [Erythranthe guttata] Length = 279 Score = 72.8 bits (177), Expect = 1e-10 Identities = 41/67 (61%), Positives = 47/67 (70%), Gaps = 1/67 (1%) Frame = -2 Query: 415 QEAGAAEMNLNSESEERLTSGEGEIELDLTLGFEPIKRCLKPKKLKLNEAD-DSAGFCKM 239 + G+AE +E E T + EIELDLTLGFEPIKRC KPK+LK +EA SAG C M Sbjct: 212 ESLGSAE---TAEPEADRTDDDEEIELDLTLGFEPIKRCPKPKELKPSEAGCKSAGVCGM 268 Query: 238 ELGLDYP 218 ELGLDYP Sbjct: 269 ELGLDYP 275 >ref|XP_012856807.1| PREDICTED: LOB domain-containing protein 41 [Erythranthe guttatus] gi|604346142|gb|EYU44639.1| hypothetical protein MIMGU_mgv1a011451mg [Erythranthe guttata] Length = 281 Score = 66.6 bits (161), Expect = 7e-09 Identities = 38/80 (47%), Positives = 48/80 (60%), Gaps = 14/80 (17%) Frame = -2 Query: 421 ADQEAGAAEMNLNSESEER------------LTSGEGEIELDLTLGFEPIKRCLKPKKLK 278 +++ A AAE N+ E R + EGEIELDLTLGFEP KR +KPK++ Sbjct: 192 SEEAAAAAETNVGIEDTARESESLASAACESASEDEGEIELDLTLGFEPFKRAVKPKEVA 251 Query: 277 LNEADD--SAGFCKMELGLD 224 + EA+D AG CKMEL LD Sbjct: 252 VKEAEDDGGAGLCKMELRLD 271 >ref|XP_011097193.1| PREDICTED: LOB domain-containing protein 41-like [Sesamum indicum] Length = 270 Score = 60.8 bits (146), Expect = 4e-07 Identities = 30/58 (51%), Positives = 41/58 (70%) Frame = -2 Query: 385 NSESEERLTSGEGEIELDLTLGFEPIKRCLKPKKLKLNEADDSAGFCKMELGLDYPAS 212 N ++ RL + + EIELDLTLG EP+KR KPK+ + ++ D+ G CKMEL L+ PAS Sbjct: 214 NFNTDHRLANDD-EIELDLTLGLEPMKRSPKPKRRQAGDSADNGGLCKMELALECPAS 270