BLASTX nr result
ID: Perilla23_contig00010724
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00010724 (383 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097323.1| PREDICTED: F-box protein At3g07870-like [Ses... 64 6e-08 ref|XP_011097347.1| PREDICTED: F-box protein At3g07870-like [Ses... 60 8e-07 ref|XP_012854958.1| PREDICTED: F-box protein CPR30-like [Erythra... 59 1e-06 ref|XP_011097335.1| PREDICTED: F-box protein At3g07870-like [Ses... 57 7e-06 >ref|XP_011097323.1| PREDICTED: F-box protein At3g07870-like [Sesamum indicum] Length = 389 Score = 63.5 bits (153), Expect = 6e-08 Identities = 30/46 (65%), Positives = 38/46 (82%) Frame = -3 Query: 213 MNQEALFAKLPSEMRIEILSRVPVGSIMSCKCVCKSWLDLILTDEF 76 MNQE LF LP+E+ I ILSR+P+ +I+SCKCVCKSWL+L+ T EF Sbjct: 1 MNQE-LFTNLPAELIINILSRLPIRTIISCKCVCKSWLNLLDTPEF 45 >ref|XP_011097347.1| PREDICTED: F-box protein At3g07870-like [Sesamum indicum] Length = 397 Score = 59.7 bits (143), Expect = 8e-07 Identities = 29/46 (63%), Positives = 36/46 (78%) Frame = -3 Query: 213 MNQEALFAKLPSEMRIEILSRVPVGSIMSCKCVCKSWLDLILTDEF 76 MNQE F LPSE+ I ILSR+P+ +I+SCKCVCKSW +L+ T EF Sbjct: 1 MNQE-FFTYLPSELIINILSRLPIRTIISCKCVCKSWHNLLDTPEF 45 >ref|XP_012854958.1| PREDICTED: F-box protein CPR30-like [Erythranthe guttatus] gi|604303400|gb|EYU22873.1| hypothetical protein MIMGU_mgv1a007630mg [Erythranthe guttata] Length = 401 Score = 59.3 bits (142), Expect = 1e-06 Identities = 32/54 (59%), Positives = 37/54 (68%) Frame = -3 Query: 234 PSSKESRMNQEALFAKLPSEMRIEILSRVPVGSIMSCKCVCKSWLDLILTDEFV 73 PS K +MN E F LPSE+ IEILSR+P+ SI CKCVCKS L+ T EFV Sbjct: 3 PSEKNPKMNPE-FFKNLPSEIIIEILSRLPIRSIAICKCVCKSSQYLLQTREFV 55 >ref|XP_011097335.1| PREDICTED: F-box protein At3g07870-like [Sesamum indicum] Length = 388 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/46 (60%), Positives = 36/46 (78%) Frame = -3 Query: 213 MNQEALFAKLPSEMRIEILSRVPVGSIMSCKCVCKSWLDLILTDEF 76 M+QE F LPSE+ I ILSR+P+ +I+SCK VCKSWL+L+ T EF Sbjct: 1 MSQE-FFTYLPSELIINILSRLPIRTIISCKSVCKSWLNLLDTPEF 45