BLASTX nr result
ID: Perilla23_contig00010712
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00010712 (379 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012837140.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 85 2e-14 ref|XP_012453241.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 83 9e-14 gb|KJB70968.1| hypothetical protein B456_011G099300 [Gossypium r... 83 9e-14 ref|XP_011088541.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 82 2e-13 ref|XP_011025935.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 82 2e-13 ref|XP_009768326.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 82 2e-13 gb|KHG12287.1| Peptidyl-prolyl cis-trans isomerase Pin1 [Gossypi... 81 3e-13 ref|XP_010033471.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 80 5e-13 ref|XP_009611087.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 80 5e-13 ref|XP_008222450.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 80 5e-13 gb|KCW53116.1| hypothetical protein EUGRSUZ_J02408, partial [Euc... 80 5e-13 ref|XP_012065595.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 80 6e-13 ref|XP_007046727.1| Peptidylprolyl cis/trans isomerase [Theobrom... 80 6e-13 ref|XP_004303637.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 80 6e-13 ref|XP_012489106.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 80 8e-13 gb|KJB40135.1| hypothetical protein B456_007G048100 [Gossypium r... 80 8e-13 gb|KHG27749.1| Peptidyl-prolyl cis-trans isomerase Pin1 [Gossypi... 80 8e-13 sp|Q9LEK8.1|PIN1_DIGLA RecName: Full=Peptidyl-prolyl cis-trans i... 79 1e-12 ref|XP_010548297.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 79 1e-12 ref|XP_007225834.1| hypothetical protein PRUPE_ppa013466mg [Prun... 79 1e-12 >ref|XP_012837140.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1-like [Erythranthe guttatus] gi|604333561|gb|EYU37912.1| hypothetical protein MIMGU_mgv1a016491mg [Erythranthe guttata] Length = 119 Score = 85.1 bits (209), Expect = 2e-14 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +1 Query: 1 LGPFGRGQMQKPFEDVTFSLKVGEISDIVDTDSGSHIIMRTG 126 LGPFGRGQMQKPFED TFSLKVGEISDI+DTDSG+HIIMRTG Sbjct: 78 LGPFGRGQMQKPFEDATFSLKVGEISDIIDTDSGAHIIMRTG 119 >ref|XP_012453241.1| PREDICTED: peptidyl-prolyl cis-trans isomerase ssp-1-like [Gossypium raimondii] Length = 274 Score = 82.8 bits (203), Expect = 9e-14 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +1 Query: 1 LGPFGRGQMQKPFEDVTFSLKVGEISDIVDTDSGSHIIMRTG 126 LGPFGRGQMQKPFED T+SLK+GEISDIVDTDSG HIIMRTG Sbjct: 233 LGPFGRGQMQKPFEDATYSLKIGEISDIVDTDSGVHIIMRTG 274 >gb|KJB70968.1| hypothetical protein B456_011G099300 [Gossypium raimondii] Length = 206 Score = 82.8 bits (203), Expect = 9e-14 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +1 Query: 1 LGPFGRGQMQKPFEDVTFSLKVGEISDIVDTDSGSHIIMRTG 126 LGPFGRGQMQKPFED T+SLK+GEISDIVDTDSG HIIMRTG Sbjct: 165 LGPFGRGQMQKPFEDATYSLKIGEISDIVDTDSGVHIIMRTG 206 >ref|XP_011088541.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1-like [Sesamum indicum] Length = 119 Score = 81.6 bits (200), Expect = 2e-13 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = +1 Query: 1 LGPFGRGQMQKPFEDVTFSLKVGEISDIVDTDSGSHIIMRTG 126 LGPFGRGQMQKPFED T+ LKVGEISDIVDTDSG HIIMRTG Sbjct: 78 LGPFGRGQMQKPFEDATYGLKVGEISDIVDTDSGVHIIMRTG 119 >ref|XP_011025935.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Populus euphratica] gi|743938484|ref|XP_011013669.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Populus euphratica] Length = 122 Score = 81.6 bits (200), Expect = 2e-13 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +1 Query: 1 LGPFGRGQMQKPFEDVTFSLKVGEISDIVDTDSGSHIIMRTG 126 LGPFGRGQMQKPFE+ TFSLKVGEISDIVDTDSG HII+RTG Sbjct: 81 LGPFGRGQMQKPFEETTFSLKVGEISDIVDTDSGVHIILRTG 122 >ref|XP_009768326.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Nicotiana sylvestris] Length = 118 Score = 81.6 bits (200), Expect = 2e-13 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = +1 Query: 1 LGPFGRGQMQKPFEDVTFSLKVGEISDIVDTDSGSHIIMRTG 126 LGPFGRGQMQKPFED TF+LKVGEISDI+DTDSG HII+RTG Sbjct: 77 LGPFGRGQMQKPFEDTTFALKVGEISDIIDTDSGVHIILRTG 118 >gb|KHG12287.1| Peptidyl-prolyl cis-trans isomerase Pin1 [Gossypium arboreum] Length = 210 Score = 80.9 bits (198), Expect = 3e-13 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = +1 Query: 1 LGPFGRGQMQKPFEDVTFSLKVGEISDIVDTDSGSHIIMRTG 126 LGPFGRGQMQKPFED T+SL +GEISDIVDTDSG HIIMRTG Sbjct: 169 LGPFGRGQMQKPFEDATYSLNIGEISDIVDTDSGVHIIMRTG 210 >ref|XP_010033471.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Eucalyptus grandis] Length = 127 Score = 80.5 bits (197), Expect = 5e-13 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = +1 Query: 1 LGPFGRGQMQKPFEDVTFSLKVGEISDIVDTDSGSHIIMRTG 126 LGPFGRGQMQKPFE+ T++LKVGEISDIVDTDSG HIIMRTG Sbjct: 86 LGPFGRGQMQKPFEEATYALKVGEISDIVDTDSGVHIIMRTG 127 >ref|XP_009611087.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Nicotiana tomentosiformis] Length = 118 Score = 80.5 bits (197), Expect = 5e-13 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = +1 Query: 1 LGPFGRGQMQKPFEDVTFSLKVGEISDIVDTDSGSHIIMRTG 126 LGPFGRGQMQKPFED TF+LKVGEISDI+DTDSG HII+RTG Sbjct: 77 LGPFGRGQMQKPFEDNTFALKVGEISDIIDTDSGVHIILRTG 118 >ref|XP_008222450.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Prunus mume] gi|645231557|ref|XP_008222451.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Prunus mume] Length = 121 Score = 80.5 bits (197), Expect = 5e-13 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = +1 Query: 1 LGPFGRGQMQKPFEDVTFSLKVGEISDIVDTDSGSHIIMRTG 126 LGPFG+GQMQKPFE+ TF+LKVGEISDIVDTDSG HIIMRTG Sbjct: 80 LGPFGKGQMQKPFEEATFALKVGEISDIVDTDSGVHIIMRTG 121 >gb|KCW53116.1| hypothetical protein EUGRSUZ_J02408, partial [Eucalyptus grandis] Length = 189 Score = 80.5 bits (197), Expect = 5e-13 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = +1 Query: 1 LGPFGRGQMQKPFEDVTFSLKVGEISDIVDTDSGSHIIMRTG 126 LGPFGRGQMQKPFE+ T++LKVGEISDIVDTDSG HIIMRTG Sbjct: 148 LGPFGRGQMQKPFEEATYALKVGEISDIVDTDSGVHIIMRTG 189 >ref|XP_012065595.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Jatropha curcas] gi|643741215|gb|KDP46719.1| hypothetical protein JCGZ_06507 [Jatropha curcas] Length = 119 Score = 80.1 bits (196), Expect = 6e-13 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +1 Query: 1 LGPFGRGQMQKPFEDVTFSLKVGEISDIVDTDSGSHIIMRTG 126 LGPFGRGQMQKPFED T++LKVGEIS+IVDTDSG HI+MRTG Sbjct: 78 LGPFGRGQMQKPFEDATYALKVGEISEIVDTDSGVHIVMRTG 119 >ref|XP_007046727.1| Peptidylprolyl cis/trans isomerase [Theobroma cacao] gi|508698988|gb|EOX90884.1| Peptidylprolyl cis/trans isomerase [Theobroma cacao] Length = 183 Score = 80.1 bits (196), Expect = 6e-13 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = +1 Query: 1 LGPFGRGQMQKPFEDVTFSLKVGEISDIVDTDSGSHIIMRTG 126 LGPFGRGQMQKPFE+ T++LKVGEISDIVDTDSG HIIMRTG Sbjct: 142 LGPFGRGQMQKPFENATYALKVGEISDIVDTDSGVHIIMRTG 183 >ref|XP_004303637.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Fragaria vesca subsp. vesca] Length = 119 Score = 80.1 bits (196), Expect = 6e-13 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = +1 Query: 1 LGPFGRGQMQKPFEDVTFSLKVGEISDIVDTDSGSHIIMRTG 126 LGPFGRGQMQKPFE+ TFSLKVGEIS+IVDTDSG HII+RTG Sbjct: 78 LGPFGRGQMQKPFEEATFSLKVGEISEIVDTDSGVHIILRTG 119 >ref|XP_012489106.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Gossypium raimondii] Length = 138 Score = 79.7 bits (195), Expect = 8e-13 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = +1 Query: 1 LGPFGRGQMQKPFEDVTFSLKVGEISDIVDTDSGSHIIMRTG 126 LGPFGRGQMQKPFED T++L +GEISDIVDTDSG HIIMRTG Sbjct: 97 LGPFGRGQMQKPFEDATYNLNIGEISDIVDTDSGVHIIMRTG 138 >gb|KJB40135.1| hypothetical protein B456_007G048100 [Gossypium raimondii] Length = 122 Score = 79.7 bits (195), Expect = 8e-13 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = +1 Query: 1 LGPFGRGQMQKPFEDVTFSLKVGEISDIVDTDSGSHIIMRTG 126 LGPFGRGQMQKPFED T++L +GEISDIVDTDSG HIIMRTG Sbjct: 81 LGPFGRGQMQKPFEDATYNLNIGEISDIVDTDSGVHIIMRTG 122 >gb|KHG27749.1| Peptidyl-prolyl cis-trans isomerase Pin1 [Gossypium arboreum] Length = 122 Score = 79.7 bits (195), Expect = 8e-13 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = +1 Query: 1 LGPFGRGQMQKPFEDVTFSLKVGEISDIVDTDSGSHIIMRTG 126 LGPFGRGQMQKPFED T++L +GEISDIVDTDSG HIIMRTG Sbjct: 81 LGPFGRGQMQKPFEDATYNLNIGEISDIVDTDSGVHIIMRTG 122 >sp|Q9LEK8.1|PIN1_DIGLA RecName: Full=Peptidyl-prolyl cis-trans isomerase Pin1; Short=PPIase Pin1; AltName: Full=DlPar13; AltName: Full=Rotamase Pin1 gi|8670992|emb|CAB94994.1| peptidyl-prolyl cis-trans isomerase [Digitalis lanata] Length = 118 Score = 79.3 bits (194), Expect = 1e-12 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = +1 Query: 1 LGPFGRGQMQKPFEDVTFSLKVGEISDIVDTDSGSHIIMRTG 126 LGPFGRGQMQKPFE+ TF+LKVGEISDIVDTDSG HII RTG Sbjct: 77 LGPFGRGQMQKPFEEATFALKVGEISDIVDTDSGVHIIKRTG 118 >ref|XP_010548297.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Tarenaya hassleriana] Length = 119 Score = 79.3 bits (194), Expect = 1e-12 Identities = 37/42 (88%), Positives = 38/42 (90%) Frame = +1 Query: 1 LGPFGRGQMQKPFEDVTFSLKVGEISDIVDTDSGSHIIMRTG 126 LGPFGRGQMQKPFED T+ LKVGEISDIVDTDSG HII RTG Sbjct: 78 LGPFGRGQMQKPFEDATYGLKVGEISDIVDTDSGVHIIKRTG 119 >ref|XP_007225834.1| hypothetical protein PRUPE_ppa013466mg [Prunus persica] gi|596287809|ref|XP_007225835.1| hypothetical protein PRUPE_ppa013466mg [Prunus persica] gi|462422770|gb|EMJ27033.1| hypothetical protein PRUPE_ppa013466mg [Prunus persica] gi|462422771|gb|EMJ27034.1| hypothetical protein PRUPE_ppa013466mg [Prunus persica] Length = 121 Score = 79.3 bits (194), Expect = 1e-12 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +1 Query: 1 LGPFGRGQMQKPFEDVTFSLKVGEISDIVDTDSGSHIIMRTG 126 LGPFG+GQMQKPFE+ TF+LKVGE+SDIVDTDSG HIIMRTG Sbjct: 80 LGPFGKGQMQKPFEEATFALKVGEMSDIVDTDSGVHIIMRTG 121