BLASTX nr result
ID: Perilla23_contig00010465
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00010465 (396 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011076987.1| PREDICTED: double-stranded RNA-binding prote... 148 2e-33 ref|XP_011084339.1| PREDICTED: double-stranded RNA-binding prote... 112 1e-22 ref|XP_012834740.1| PREDICTED: double-stranded RNA-binding prote... 74 6e-11 ref|XP_009598424.1| PREDICTED: double-stranded RNA-binding prote... 63 1e-07 ref|XP_009606187.1| PREDICTED: double-stranded RNA-binding prote... 62 1e-07 ref|XP_009762406.1| PREDICTED: double-stranded RNA-binding prote... 60 5e-07 emb|CDO99742.1| unnamed protein product [Coffea canephora] 57 7e-06 >ref|XP_011076987.1| PREDICTED: double-stranded RNA-binding protein 2-like [Sesamum indicum] Length = 481 Score = 148 bits (373), Expect = 2e-33 Identities = 77/140 (55%), Positives = 96/140 (68%), Gaps = 9/140 (6%) Frame = -2 Query: 395 PPTLGMAPPVSIRQAVPVFAAPVRMEELPMTHPSVKVEDPRVSRPTTPQVEEPSFSRGVP 216 PP LGMAPPVS+RQA+PVFAAPVRMEELP+ HP++KVEDPR+S TT + +EP SR Sbjct: 326 PPVLGMAPPVSVRQAIPVFAAPVRMEELPIVHPAIKVEDPRLSISTTARADEPPVSRAAL 385 Query: 215 STLDDSPLSKLPSVLVQDPSGFK-KPVLSAPNSEAPTIPVDLATSEVLTVEVK------- 60 L+DSP+ K+PSV V++P FK PV PNS+ PT+ VD +S+ LT V+ Sbjct: 386 GRLEDSPIPKVPSVRVEEPLSFKLLPVSITPNSDIPTVQVDPPSSDALTARVESPVCKVT 445 Query: 59 -PPVSAKPSAEETVSEKQDK 3 PP S+K S EET QDK Sbjct: 446 SPPASSKASGEETKIAVQDK 465 >ref|XP_011084339.1| PREDICTED: double-stranded RNA-binding protein 2-like [Sesamum indicum] Length = 479 Score = 112 bits (280), Expect = 1e-22 Identities = 63/133 (47%), Positives = 80/133 (60%), Gaps = 9/133 (6%) Frame = -2 Query: 395 PPTLGMAPPVSIRQAVPVFAAPVRMEELPMTHPSVKVEDPRVSRPTTPQVEEPSFSRGVP 216 PP LGMAPPV +RQAVP+ AAPVRM+E P+ HP+ KVEDP++SRP + EE SR P Sbjct: 325 PPALGMAPPVCVRQAVPLCAAPVRMDEPPIVHPAAKVEDPQLSRPRRDRAEELMVSRAAP 384 Query: 215 STLDDSPLSKLPSVLVQDPSGFKK-PVLSAPNSEAPTIPVDLATSEVLTVEVKPPVS--- 48 L++ P KLP + +P K P AP SE ++ +SEV TV+V P S Sbjct: 385 GRLEEKPFPKLPVIPANEPLDRKSLPCCIAPTSEVAPDQLEQPSSEVSTVQVGSPFSKVS 444 Query: 47 -----AKPSAEET 24 +K SAEET Sbjct: 445 SSLLGSKGSAEET 457 >ref|XP_012834740.1| PREDICTED: double-stranded RNA-binding protein 2-like [Erythranthe guttatus] gi|604335711|gb|EYU39599.1| hypothetical protein MIMGU_mgv1a006880mg [Erythranthe guttata] Length = 428 Score = 73.6 bits (179), Expect = 6e-11 Identities = 48/128 (37%), Positives = 64/128 (50%), Gaps = 1/128 (0%) Frame = -2 Query: 395 PPTLGMAPPVSIRQAVPVFAAPVRMEELPMTHPSVKVEDPRVSRPTTPQVEEPSFSRGVP 216 PP +APPV +R +VP FAAPVRM+E + VK+EDPR+S+ T +VE Sbjct: 328 PPAPAIAPPVCVRHSVPAFAAPVRMKERTTGNVVVKIEDPRISKSPTVEVE--------- 378 Query: 215 STLDDSPLSKLPSVLVQDPSGFKKPVLSAPNSE-APTIPVDLATSEVLTVEVKPPVSAKP 39 KP +S P+SE PT+ + SEV T PP S++ Sbjct: 379 -----------------------KPPVSLPSSEVVPTVQAEATVSEVST----PPASSQA 411 Query: 38 SAEETVSE 15 SAEET +E Sbjct: 412 SAEETSAE 419 >ref|XP_009598424.1| PREDICTED: double-stranded RNA-binding protein 2-like [Nicotiana tomentosiformis] Length = 472 Score = 62.8 bits (151), Expect = 1e-07 Identities = 50/137 (36%), Positives = 71/137 (51%), Gaps = 11/137 (8%) Frame = -2 Query: 392 PTLGMAPPVSIRQAVPVFAA-PVRMEELPMTHPSVKVEDPRVSRPTTPQVEEPSFSRGVP 216 P LG+APPV +RQA+PV+AA P+R E+LP +++V +P S+ QVEEP S G Sbjct: 336 PGLGVAPPVCVRQAMPVYAAPPIRAEKLPTLDTALQVVEPTFSKAPPVQVEEPVASEG-- 393 Query: 215 STLDDSPLSKLPSVLVQDPSGFKKPVLSAPNSE-------APT---IPVDLATSEVLTVE 66 + P+ +LP+ KP L+ +SE PT PVD S +T+ Sbjct: 394 ---PEIPVHELPTCKAVP----GKPELAHEHSEEQPCSQLQPTKREEPVDFEISTSVTIP 446 Query: 65 VKPPVSAKPSAEETVSE 15 V+ K +AEE E Sbjct: 447 VE---GTKTAAEEKPQE 460 >ref|XP_009606187.1| PREDICTED: double-stranded RNA-binding protein 2-like [Nicotiana tomentosiformis] Length = 481 Score = 62.4 bits (150), Expect = 1e-07 Identities = 48/131 (36%), Positives = 68/131 (51%), Gaps = 7/131 (5%) Frame = -2 Query: 395 PPTLGMAPPVSIRQAVPVFAA-PVRMEELPMTHPSVKVEDPRVSRPTTPQVEEPSFSRGV 219 PP G+APPV +RQ VPV+AA P R EELP+ P+++V+ P SR QVEE + Sbjct: 336 PPGFGVAPPVCVRQTVPVYAAPPTRPEELPVLDPALEVKKPLYSRTPPVQVEEQLALKEP 395 Query: 218 PSTLDDSPLSKLPS------VLVQDPSGFKKPVLSAPNSEAPTIPVDLATSEVLTVEVKP 57 + DS + PS V V++ G + + E PT ++L V+V Sbjct: 396 EIQVHDSSIKVAPSPQCLAEVHVEERPGSR---VQPSQLEKPT------DFDILPVQV-D 445 Query: 56 PVSAKPSAEET 24 PV++K SA T Sbjct: 446 PVASKNSATPT 456 >ref|XP_009762406.1| PREDICTED: double-stranded RNA-binding protein 2-like [Nicotiana sylvestris] Length = 481 Score = 60.5 bits (145), Expect = 5e-07 Identities = 47/126 (37%), Positives = 64/126 (50%), Gaps = 2/126 (1%) Frame = -2 Query: 395 PPTLGMAPPVSIRQAVPVFAA-PVRMEELPMTHPSVKVEDPRVSRPTTPQVEEPSFSRGV 219 PP G+APPV +RQ VPV+AA P R EELP P++++ P SR +VEE + Sbjct: 336 PPGFGVAPPVCVRQTVPVYAAPPTRSEELPALDPALELRKPLFSRTAPVRVEEQLALKEP 395 Query: 218 PSTLDDSPLSKLPSVLVQDPSGFKKPVLSAPNSEAPTIPVDLATS-EVLTVEVKPPVSAK 42 + DS + PS Q SG V P S ++ T +L V+V PV++K Sbjct: 396 EIQVHDSSIKVAPS--PQCLSGVH--VEERPGSRVQPAQLEKPTDFNILPVQV-DPVASK 450 Query: 41 PSAEET 24 SA T Sbjct: 451 NSATPT 456 >emb|CDO99742.1| unnamed protein product [Coffea canephora] Length = 438 Score = 56.6 bits (135), Expect = 7e-06 Identities = 31/70 (44%), Positives = 47/70 (67%), Gaps = 1/70 (1%) Frame = -2 Query: 395 PPTLGMAPPVSIRQAVPVFAA-PVRMEELPMTHPSVKVEDPRVSRPTTPQVEEPSFSRGV 219 PPT GMAPPV +RQA+P ++A PVR+E+L + +++ E P +P + EEP S+ V Sbjct: 345 PPTSGMAPPVCLRQAIPSYSAPPVRLEQLSLLDAAIE-EQPPFPKPPVIKFEEPLGSK-V 402 Query: 218 PSTLDDSPLS 189 P T ++P+S Sbjct: 403 PQTQIENPIS 412