BLASTX nr result
ID: Perilla23_contig00010464
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00010464 (396 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011076987.1| PREDICTED: double-stranded RNA-binding prote... 135 2e-29 ref|XP_011084339.1| PREDICTED: double-stranded RNA-binding prote... 105 2e-20 ref|XP_012834740.1| PREDICTED: double-stranded RNA-binding prote... 63 8e-08 ref|XP_009606187.1| PREDICTED: double-stranded RNA-binding prote... 60 6e-07 ref|XP_009598424.1| PREDICTED: double-stranded RNA-binding prote... 60 8e-07 ref|XP_009762406.1| PREDICTED: double-stranded RNA-binding prote... 57 5e-06 emb|CDO99742.1| unnamed protein product [Coffea canephora] 57 7e-06 >ref|XP_011076987.1| PREDICTED: double-stranded RNA-binding protein 2-like [Sesamum indicum] Length = 481 Score = 135 bits (339), Expect = 2e-29 Identities = 72/134 (53%), Positives = 90/134 (67%), Gaps = 3/134 (2%) Frame = -2 Query: 395 PPTLGMAPPVSIRQAVPVFAAPVRMEELPMTHPSVKVEDPRVSRPTTPQVEEPSFSRGVP 216 PP LGMAPPVS+RQA+PVFAAPVRMEELP+ HP++KVEDPR+S TT + +EP SR Sbjct: 326 PPVLGMAPPVSVRQAIPVFAAPVRMEELPIVHPAIKVEDPRLSISTTARADEPPVSRAAL 385 Query: 215 STLDDSPLSKLPSVLVQDPSGFK-KPVLSAPNSEAPTVPVDLATSEVLT--VEXXXXXXX 45 L+DSP+ K+PSV V++P FK PV PNS+ PTV VD +S+ LT VE Sbjct: 386 GRLEDSPIPKVPSVRVEEPLSFKLLPVSITPNSDIPTVQVDPPSSDALTARVESPVCKVT 445 Query: 44 XXSAEETASEKQDK 3 A AS ++ K Sbjct: 446 SPPASSKASGEETK 459 >ref|XP_011084339.1| PREDICTED: double-stranded RNA-binding protein 2-like [Sesamum indicum] Length = 479 Score = 105 bits (261), Expect = 2e-20 Identities = 54/111 (48%), Positives = 70/111 (63%), Gaps = 1/111 (0%) Frame = -2 Query: 395 PPTLGMAPPVSIRQAVPVFAAPVRMEELPMTHPSVKVEDPRVSRPTTPQVEEPSFSRGVP 216 PP LGMAPPV +RQAVP+ AAPVRM+E P+ HP+ KVEDP++SRP + EE SR P Sbjct: 325 PPALGMAPPVCVRQAVPLCAAPVRMDEPPIVHPAAKVEDPQLSRPRRDRAEELMVSRAAP 384 Query: 215 STLDDSPLSKLPSVLVQDPSGFKK-PVLSAPNSEAPTVPVDLATSEVLTVE 66 L++ P KLP + +P K P AP SE ++ +SEV TV+ Sbjct: 385 GRLEEKPFPKLPVIPANEPLDRKSLPCCIAPTSEVAPDQLEQPSSEVSTVQ 435 >ref|XP_012834740.1| PREDICTED: double-stranded RNA-binding protein 2-like [Erythranthe guttatus] gi|604335711|gb|EYU39599.1| hypothetical protein MIMGU_mgv1a006880mg [Erythranthe guttata] Length = 428 Score = 63.2 bits (152), Expect = 8e-08 Identities = 46/128 (35%), Positives = 60/128 (46%), Gaps = 1/128 (0%) Frame = -2 Query: 395 PPTLGMAPPVSIRQAVPVFAAPVRMEELPMTHPSVKVEDPRVSRPTTPQVEEPSFSRGVP 216 PP +APPV +R +VP FAAPVRM+E + VK+EDPR+S+ T +VE Sbjct: 328 PPAPAIAPPVCVRHSVPAFAAPVRMKERTTGNVVVKIEDPRISKSPTVEVE--------- 378 Query: 215 STLDDSPLSKLPSVLVQDPSGFKKPVLSAPNSE-APTVPVDLATSEVLTVEXXXXXXXXX 39 KP +S P+SE PTV + SEV T Sbjct: 379 -----------------------KPPVSLPSSEVVPTVQAEATVSEVST----PPASSQA 411 Query: 38 SAEETASE 15 SAEET++E Sbjct: 412 SAEETSAE 419 >ref|XP_009606187.1| PREDICTED: double-stranded RNA-binding protein 2-like [Nicotiana tomentosiformis] Length = 481 Score = 60.1 bits (144), Expect = 6e-07 Identities = 33/74 (44%), Positives = 44/74 (59%), Gaps = 1/74 (1%) Frame = -2 Query: 395 PPTLGMAPPVSIRQAVPVFAA-PVRMEELPMTHPSVKVEDPRVSRPTTPQVEEPSFSRGV 219 PP G+APPV +RQ VPV+AA P R EELP+ P+++V+ P SR QVEE + Sbjct: 336 PPGFGVAPPVCVRQTVPVYAAPPTRPEELPVLDPALEVKKPLYSRTPPVQVEEQLALKEP 395 Query: 218 PSTLDDSPLSKLPS 177 + DS + PS Sbjct: 396 EIQVHDSSIKVAPS 409 >ref|XP_009598424.1| PREDICTED: double-stranded RNA-binding protein 2-like [Nicotiana tomentosiformis] Length = 472 Score = 59.7 bits (143), Expect = 8e-07 Identities = 39/113 (34%), Positives = 58/113 (51%), Gaps = 4/113 (3%) Frame = -2 Query: 392 PTLGMAPPVSIRQAVPVFAA-PVRMEELPMTHPSVKVEDPRVSRPTTPQVEEPSFSRGVP 216 P LG+APPV +RQA+PV+AA P+R E+LP +++V +P S+ QVEEP S G Sbjct: 336 PGLGVAPPVCVRQAMPVYAAPPIRAEKLPTLDTALQVVEPTFSKAPPVQVEEPVASEGPE 395 Query: 215 STLDDSPLSKL---PSVLVQDPSGFKKPVLSAPNSEAPTVPVDLATSEVLTVE 66 + + P K L + S + P V +++TS + VE Sbjct: 396 IPVHELPTCKAVPGKPELAHEHSEEQPCSQLQPTKREEPVDFEISTSVTIPVE 448 >ref|XP_009762406.1| PREDICTED: double-stranded RNA-binding protein 2-like [Nicotiana sylvestris] Length = 481 Score = 57.0 bits (136), Expect = 5e-06 Identities = 31/74 (41%), Positives = 42/74 (56%), Gaps = 1/74 (1%) Frame = -2 Query: 395 PPTLGMAPPVSIRQAVPVFAA-PVRMEELPMTHPSVKVEDPRVSRPTTPQVEEPSFSRGV 219 PP G+APPV +RQ VPV+AA P R EELP P++++ P SR +VEE + Sbjct: 336 PPGFGVAPPVCVRQTVPVYAAPPTRSEELPALDPALELRKPLFSRTAPVRVEEQLALKEP 395 Query: 218 PSTLDDSPLSKLPS 177 + DS + PS Sbjct: 396 EIQVHDSSIKVAPS 409 >emb|CDO99742.1| unnamed protein product [Coffea canephora] Length = 438 Score = 56.6 bits (135), Expect = 7e-06 Identities = 31/70 (44%), Positives = 47/70 (67%), Gaps = 1/70 (1%) Frame = -2 Query: 395 PPTLGMAPPVSIRQAVPVFAA-PVRMEELPMTHPSVKVEDPRVSRPTTPQVEEPSFSRGV 219 PPT GMAPPV +RQA+P ++A PVR+E+L + +++ E P +P + EEP S+ V Sbjct: 345 PPTSGMAPPVCLRQAIPSYSAPPVRLEQLSLLDAAIE-EQPPFPKPPVIKFEEPLGSK-V 402 Query: 218 PSTLDDSPLS 189 P T ++P+S Sbjct: 403 PQTQIENPIS 412