BLASTX nr result
ID: Perilla23_contig00010350
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00010350 (321 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012850406.1| PREDICTED: putative elongation of fatty acid... 70 8e-10 ref|XP_011074550.1| PREDICTED: elongation of fatty acids protein... 65 1e-08 ref|XP_011087771.1| PREDICTED: putative elongation of fatty acid... 64 4e-08 ref|XP_012843160.1| PREDICTED: LOW QUALITY PROTEIN: putative elo... 62 1e-07 >ref|XP_012850406.1| PREDICTED: putative elongation of fatty acids protein DDB_G0272012 [Erythranthe guttatus] gi|604313219|gb|EYU26550.1| hypothetical protein MIMGU_mgv1a011362mg [Erythranthe guttata] Length = 284 Score = 69.7 bits (169), Expect = 8e-10 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = -1 Query: 186 MATLYTTTRYWLVDHPTISQYEWKPNQTPGASPVFVAA 73 M TLYTT YWLVDHP ISQYEWKPNQTPGAS +F+ A Sbjct: 1 MDTLYTTVHYWLVDHPIISQYEWKPNQTPGASLLFLTA 38 >ref|XP_011074550.1| PREDICTED: elongation of fatty acids protein 3-like [Sesamum indicum] Length = 282 Score = 65.5 bits (158), Expect = 1e-08 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -1 Query: 186 MATLYTTTRYWLVDHPTISQYEWKPNQTPGASPVFVA 76 MATLY YWLVDHP I+QYEWKP Q+PGASP+F++ Sbjct: 1 MATLYRAVHYWLVDHPIITQYEWKPRQSPGASPLFLS 37 >ref|XP_011087771.1| PREDICTED: putative elongation of fatty acids protein DDB_G0272012 [Sesamum indicum] Length = 278 Score = 63.9 bits (154), Expect = 4e-08 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = -1 Query: 186 MATLYTTTRYWLVDHPTISQYEWKPNQTPGASPVFVA 76 M TLY T YWLVDHP I+ Y W PNQTPGASP+FVA Sbjct: 1 MDTLYATIHYWLVDHPFITHYHWIPNQTPGASPLFVA 37 >ref|XP_012843160.1| PREDICTED: LOW QUALITY PROTEIN: putative elongation of fatty acids protein DDB_G0272012 [Erythranthe guttatus] Length = 255 Score = 62.4 bits (150), Expect = 1e-07 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = -1 Query: 183 ATLYTTTRYWLVDHPTISQYEWKPNQTPGASPVFVA 76 ATLY YWLVDHP ISQYEW+P TPGASP FV+ Sbjct: 37 ATLYDAVHYWLVDHPIISQYEWQPGVTPGASPFFVS 72