BLASTX nr result
ID: Perilla23_contig00010301
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00010301 (335 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012847378.1| PREDICTED: uncharacterized protein LOC105967... 56 9e-06 gb|EYU29017.1| hypothetical protein MIMGU_mgv1a017274mg [Erythra... 56 9e-06 >ref|XP_012847378.1| PREDICTED: uncharacterized protein LOC105967325 [Erythranthe guttatus] Length = 205 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +3 Query: 3 EAEKISDLMDKVEEIDDKLEEFLDKKFKGTGKA 101 +A+K+ DLMDKVEE+DDK+EEFL+ KF GTGKA Sbjct: 173 DAQKVEDLMDKVEELDDKVEEFLNNKFNGTGKA 205 >gb|EYU29017.1| hypothetical protein MIMGU_mgv1a017274mg [Erythranthe guttata] Length = 85 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +3 Query: 3 EAEKISDLMDKVEEIDDKLEEFLDKKFKGTGKA 101 +A+K+ DLMDKVEE+DDK+EEFL+ KF GTGKA Sbjct: 53 DAQKVEDLMDKVEELDDKVEEFLNNKFNGTGKA 85