BLASTX nr result
ID: Perilla23_contig00010293
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00010293 (312 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011082634.1| PREDICTED: HUA2-like protein 2 [Sesamum indi... 79 1e-12 ref|XP_011079974.1| PREDICTED: HUA2-like protein 2 [Sesamum indi... 71 3e-10 ref|XP_012836137.1| PREDICTED: HUA2-like protein 2 [Erythranthe ... 70 5e-10 emb|CDP03601.1| unnamed protein product [Coffea canephora] 66 1e-08 >ref|XP_011082634.1| PREDICTED: HUA2-like protein 2 [Sesamum indicum] Length = 1651 Score = 79.0 bits (193), Expect = 1e-12 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +2 Query: 191 FQPMDGAFSKGFHLPPPHPAPSDQFSYVQEQRIQSRRDIP 310 FQP+D AFSKGFHL PPHPAPS+QFSYV+EQRIQSRRDIP Sbjct: 1297 FQPVDSAFSKGFHLRPPHPAPSNQFSYVREQRIQSRRDIP 1336 >ref|XP_011079974.1| PREDICTED: HUA2-like protein 2 [Sesamum indicum] Length = 1402 Score = 71.2 bits (173), Expect = 3e-10 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = +2 Query: 194 QPMDGAFSKGFHLPPPHPAPSDQFSYVQEQRIQSRRDIP 310 QP D FSKGFHL PPHPAPS+QFSYVQEQRIQSRRDIP Sbjct: 1253 QPTD-TFSKGFHLRPPHPAPSNQFSYVQEQRIQSRRDIP 1290 >ref|XP_012836137.1| PREDICTED: HUA2-like protein 2 [Erythranthe guttatus] Length = 1658 Score = 70.5 bits (171), Expect = 5e-10 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +2 Query: 197 PMDGAFSKGFHLPPPHPAPSDQFSYVQEQRIQSRRDIP 310 P + +F KG+HLPPPHPAPS+QFSYVQEQR QSRRDIP Sbjct: 1310 PPNDSFGKGYHLPPPHPAPSNQFSYVQEQRTQSRRDIP 1347 >emb|CDP03601.1| unnamed protein product [Coffea canephora] Length = 1406 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/39 (76%), Positives = 34/39 (87%), Gaps = 1/39 (2%) Frame = +2 Query: 197 PMDGAFSKGFHLPPPHPAPSDQFSYVQ-EQRIQSRRDIP 310 P DGAF+KGFHL PPHPAPS+QFSY+Q + R QSRRDIP Sbjct: 1261 PADGAFNKGFHLRPPHPAPSNQFSYMQVDHRAQSRRDIP 1299