BLASTX nr result
ID: Perilla23_contig00010011
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00010011 (312 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011070018.1| PREDICTED: grpE protein homolog, mitochondri... 67 4e-09 ref|XP_009762578.1| PREDICTED: grpE protein homolog, mitochondri... 64 6e-08 ref|XP_009592593.1| PREDICTED: grpE protein homolog, mitochondri... 64 6e-08 ref|XP_012839556.1| PREDICTED: grpE protein homolog, mitochondri... 62 1e-07 ref|XP_004493255.1| PREDICTED: grpE protein homolog, mitochondri... 62 2e-07 ref|XP_004493254.1| PREDICTED: grpE protein homolog, mitochondri... 62 2e-07 ref|XP_006339226.1| PREDICTED: grpE protein homolog, mitochondri... 62 2e-07 ref|XP_014491397.1| PREDICTED: protein GrpE [Vigna radiata var. ... 61 3e-07 ref|XP_002267243.1| PREDICTED: grpE protein homolog, mitochondri... 61 3e-07 ref|XP_003554067.1| PREDICTED: grpE protein homolog, mitochondri... 61 3e-07 ref|XP_008810324.1| PREDICTED: grpE protein homolog, mitochondri... 60 5e-07 ref|XP_010942073.1| PREDICTED: grpE protein homolog, mitochondri... 60 6e-07 ref|XP_004249350.1| PREDICTED: grpE protein homolog, mitochondri... 60 6e-07 gb|KOM38638.1| hypothetical protein LR48_Vigan03g202000 [Vigna a... 60 8e-07 ref|XP_007029907.1| Co-chaperone GrpE family protein [Theobroma ... 60 8e-07 ref|XP_010036281.1| PREDICTED: grpE protein homolog, mitochondri... 59 1e-06 ref|XP_011047049.1| PREDICTED: grpE protein homolog, mitochondri... 59 1e-06 ref|XP_011047048.1| PREDICTED: grpE protein homolog, mitochondri... 59 1e-06 ref|XP_002530954.1| Protein grpE, putative [Ricinus communis] gi... 59 1e-06 ref|XP_002319738.1| co-chaperone grpE family protein [Populus tr... 59 1e-06 >ref|XP_011070018.1| PREDICTED: grpE protein homolog, mitochondrial [Sesamum indicum] Length = 352 Score = 67.4 bits (163), Expect = 4e-09 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -1 Query: 312 KGFQLGDRLLRPSMVKVSAGPGPAKPETGGQSEEQ 208 KGF LG+RLLRPSMVKVSAGPGPAKPETGGQSE Q Sbjct: 298 KGFLLGERLLRPSMVKVSAGPGPAKPETGGQSEVQ 332 >ref|XP_009762578.1| PREDICTED: grpE protein homolog, mitochondrial [Nicotiana sylvestris] Length = 296 Score = 63.5 bits (153), Expect = 6e-08 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -1 Query: 312 KGFQLGDRLLRPSMVKVSAGPGPAKPETGGQSEEQ 208 KGF+LGDRLLRPSMVKVSAGPGPAKPET EEQ Sbjct: 237 KGFKLGDRLLRPSMVKVSAGPGPAKPETAEPKEEQ 271 >ref|XP_009592593.1| PREDICTED: grpE protein homolog, mitochondrial isoform X1 [Nicotiana tomentosiformis] Length = 354 Score = 63.5 bits (153), Expect = 6e-08 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -1 Query: 312 KGFQLGDRLLRPSMVKVSAGPGPAKPETGGQSEEQ 208 KGF+LGDRLLRPSMVKVSAGPGPAKPET EEQ Sbjct: 295 KGFKLGDRLLRPSMVKVSAGPGPAKPETAEPKEEQ 329 >ref|XP_012839556.1| PREDICTED: grpE protein homolog, mitochondrial isoform X1 [Erythranthe guttatus] gi|604330674|gb|EYU35657.1| hypothetical protein MIMGU_mgv1a009214mg [Erythranthe guttata] Length = 349 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = -1 Query: 312 KGFQLGDRLLRPSMVKVSAGPGPAKPETGGQSEEQ 208 KGFQLGDRLLRPSMVKVSAGPGP KPE G QS Q Sbjct: 295 KGFQLGDRLLRPSMVKVSAGPGPTKPEGGAQSVVQ 329 >ref|XP_004493255.1| PREDICTED: grpE protein homolog, mitochondrial isoform X2 [Cicer arietinum] Length = 331 Score = 62.0 bits (149), Expect = 2e-07 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = -1 Query: 312 KGFQLGDRLLRPSMVKVSAGPGPAKPETGGQSEEQ 208 KGFQLGDRLLRPSMVKVSAGPGPAKPE EEQ Sbjct: 276 KGFQLGDRLLRPSMVKVSAGPGPAKPEQEVSQEEQ 310 >ref|XP_004493254.1| PREDICTED: grpE protein homolog, mitochondrial isoform X1 [Cicer arietinum] Length = 333 Score = 62.0 bits (149), Expect = 2e-07 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = -1 Query: 312 KGFQLGDRLLRPSMVKVSAGPGPAKPETGGQSEEQ 208 KGFQLGDRLLRPSMVKVSAGPGPAKPE EEQ Sbjct: 278 KGFQLGDRLLRPSMVKVSAGPGPAKPEQEVSQEEQ 312 >ref|XP_006339226.1| PREDICTED: grpE protein homolog, mitochondrial-like [Solanum tuberosum] Length = 357 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -1 Query: 312 KGFQLGDRLLRPSMVKVSAGPGPAKPETGGQSEEQ 208 KGF+LGDRLLRPSMVKVSAGPGPAKPET EE+ Sbjct: 297 KGFKLGDRLLRPSMVKVSAGPGPAKPETTEPKEEE 331 >ref|XP_014491397.1| PREDICTED: protein GrpE [Vigna radiata var. radiata] Length = 335 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -1 Query: 312 KGFQLGDRLLRPSMVKVSAGPGPAKPETGGQSEEQ 208 KGF+LGDRLLRPSMVKVSAGPGPAKPE EEQ Sbjct: 280 KGFKLGDRLLRPSMVKVSAGPGPAKPEQEAPQEEQ 314 >ref|XP_002267243.1| PREDICTED: grpE protein homolog, mitochondrial isoform X1 [Vitis vinifera] Length = 338 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -1 Query: 312 KGFQLGDRLLRPSMVKVSAGPGPAKPETGGQSEEQ 208 KGF+LGDRLLRPSMVKVSAGPGPAK E G SEE+ Sbjct: 284 KGFKLGDRLLRPSMVKVSAGPGPAKAEAVGSSEEE 318 >ref|XP_003554067.1| PREDICTED: grpE protein homolog, mitochondrial-like isoform X1 [Glycine max] gi|734408238|gb|KHN34620.1| Protein grpE [Glycine soja] gi|947045316|gb|KRG94945.1| hypothetical protein GLYMA_19G120100 [Glycine max] Length = 338 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -1 Query: 312 KGFQLGDRLLRPSMVKVSAGPGPAKPETGGQSEEQ 208 KGF+LGDRLLRPSMVKVSAGPGPAKPE EEQ Sbjct: 283 KGFKLGDRLLRPSMVKVSAGPGPAKPEQEAPQEEQ 317 >ref|XP_008810324.1| PREDICTED: grpE protein homolog, mitochondrial-like, partial [Phoenix dactylifera] Length = 270 Score = 60.5 bits (145), Expect = 5e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -1 Query: 312 KGFQLGDRLLRPSMVKVSAGPGPAKPETGGQSEEQ 208 KGF+LG+RLLRPSMVKVSAGPGPAKPE GG ++ Sbjct: 219 KGFKLGERLLRPSMVKVSAGPGPAKPEDGGSPADE 253 >ref|XP_010942073.1| PREDICTED: grpE protein homolog, mitochondrial [Elaeis guineensis] Length = 328 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = -1 Query: 312 KGFQLGDRLLRPSMVKVSAGPGPAKPETGGQSEEQ 208 KGF++G+RLLRPSMVKVSAGPGPAKPE GG + ++ Sbjct: 277 KGFKIGERLLRPSMVKVSAGPGPAKPEGGGSTADE 311 >ref|XP_004249350.1| PREDICTED: grpE protein homolog, mitochondrial [Solanum lycopersicum] Length = 352 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -1 Query: 312 KGFQLGDRLLRPSMVKVSAGPGPAKPETGGQSEEQ 208 KGF+LGDRLLRPSMVKVSAGPGPAKPET E++ Sbjct: 296 KGFRLGDRLLRPSMVKVSAGPGPAKPETTEPKEKE 330 >gb|KOM38638.1| hypothetical protein LR48_Vigan03g202000 [Vigna angularis] Length = 335 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 312 KGFQLGDRLLRPSMVKVSAGPGPAKPETGGQSEEQ 208 KGF+LGDRLLRPSMVKVSAGPGPAKPE +EQ Sbjct: 280 KGFKLGDRLLRPSMVKVSAGPGPAKPEQEAPQKEQ 314 >ref|XP_007029907.1| Co-chaperone GrpE family protein [Theobroma cacao] gi|508718512|gb|EOY10409.1| Co-chaperone GrpE family protein [Theobroma cacao] Length = 348 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 312 KGFQLGDRLLRPSMVKVSAGPGPAKPETGGQS 217 KGF+LGDRLLRPSMVKVSAGPGPAKPE G S Sbjct: 281 KGFKLGDRLLRPSMVKVSAGPGPAKPEQGESS 312 >ref|XP_010036281.1| PREDICTED: grpE protein homolog, mitochondrial isoform X1 [Eucalyptus grandis] gi|629081366|gb|KCW47811.1| hypothetical protein EUGRSUZ_K01549 [Eucalyptus grandis] Length = 333 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -1 Query: 312 KGFQLGDRLLRPSMVKVSAGPGPAKPETGGQSEEQ 208 KGF+LG+RLLRPSMVKVSAGPGPAKPE +EE+ Sbjct: 281 KGFKLGERLLRPSMVKVSAGPGPAKPEAAPATEEE 315 >ref|XP_011047049.1| PREDICTED: grpE protein homolog, mitochondrial isoform X2 [Populus euphratica] Length = 337 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -1 Query: 312 KGFQLGDRLLRPSMVKVSAGPGPAKPETGGQSEEQ 208 KGF+LGDRLLRPSMVKVSAGPGP KPE +S+E+ Sbjct: 285 KGFKLGDRLLRPSMVKVSAGPGPVKPEQVEESQEE 319 >ref|XP_011047048.1| PREDICTED: grpE protein homolog, mitochondrial isoform X1 [Populus euphratica] Length = 338 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -1 Query: 312 KGFQLGDRLLRPSMVKVSAGPGPAKPETGGQSEEQ 208 KGF+LGDRLLRPSMVKVSAGPGP KPE +S+E+ Sbjct: 286 KGFKLGDRLLRPSMVKVSAGPGPVKPEQVEESQEE 320 >ref|XP_002530954.1| Protein grpE, putative [Ricinus communis] gi|223529469|gb|EEF31426.1| Protein grpE, putative [Ricinus communis] Length = 356 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -1 Query: 312 KGFQLGDRLLRPSMVKVSAGPGPAKPETGGQSEE 211 KGF+LGDRLLRPSMVKVSAGPGPAKPE S E Sbjct: 304 KGFKLGDRLLRPSMVKVSAGPGPAKPEQAESSAE 337 >ref|XP_002319738.1| co-chaperone grpE family protein [Populus trichocarpa] gi|222858114|gb|EEE95661.1| co-chaperone grpE family protein [Populus trichocarpa] Length = 342 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -1 Query: 312 KGFQLGDRLLRPSMVKVSAGPGPAKPETGGQSEEQ 208 KGF+LGDRLLRPSMVKVSAGPGP KPE +S+E+ Sbjct: 290 KGFKLGDRLLRPSMVKVSAGPGPVKPEQVEESQEE 324