BLASTX nr result
ID: Perilla23_contig00009982
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00009982 (434 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011071752.1| PREDICTED: two-component response regulator ... 54 2e-08 ref|XP_012831142.1| PREDICTED: two-component response regulator ... 52 7e-08 gb|AAQ10675.1| type-A response regulator [Catharanthus roseus] 51 2e-07 ref|XP_008239693.1| PREDICTED: two-component response regulator ... 49 3e-07 ref|XP_006344995.1| PREDICTED: two-component response regulator ... 49 3e-07 ref|XP_004236156.1| PREDICTED: two-component response regulator ... 49 3e-07 ref|XP_012831141.1| PREDICTED: two-component response regulator ... 50 3e-07 ref|XP_007208910.1| hypothetical protein PRUPE_ppa027113mg, part... 49 3e-07 ref|XP_014496480.1| PREDICTED: two-component response regulator ... 48 3e-07 gb|KOM40350.1| hypothetical protein LR48_Vigan04g054800 [Vigna a... 48 3e-07 ref|XP_007138131.1| hypothetical protein PHAVU_009G182800g [Phas... 48 3e-07 ref|XP_006577761.1| PREDICTED: uncharacterized protein LOC100306... 46 4e-07 ref|NP_001238384.1| uncharacterized protein LOC100306152 [Glycin... 46 4e-07 ref|XP_004299595.1| PREDICTED: two-component response regulator ... 49 4e-07 ref|XP_011028649.1| PREDICTED: two-component response regulator ... 47 6e-07 ref|XP_012080154.1| PREDICTED: two-component response regulator ... 47 6e-07 ref|XP_006476689.1| PREDICTED: two-component response regulator ... 49 6e-07 ref|XP_006439725.1| hypothetical protein CICLE_v10022334mg [Citr... 49 6e-07 ref|XP_011028652.1| PREDICTED: two-component response regulator ... 47 7e-07 ref|XP_008374475.1| PREDICTED: two-component response regulator ... 48 7e-07 >ref|XP_011071752.1| PREDICTED: two-component response regulator ARR5-like [Sesamum indicum] Length = 206 Score = 53.5 bits (127), Expect(2) = 2e-08 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -2 Query: 367 LSCSVVSAVESGSRALQYLGLDGERSSVEFDVRKV 263 +SC V+AVESG RALQYLGLDGERSSV FD KV Sbjct: 37 ISCCKVTAVESGRRALQYLGLDGERSSVGFDELKV 71 Score = 31.6 bits (70), Expect(2) = 2e-08 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = -1 Query: 194 LLQTIPCMSGMTGYELLKKIKKCS 123 L+ T M GMTGYELLKKIK S Sbjct: 73 LIMTDYSMPGMTGYELLKKIKGSS 96 >ref|XP_012831142.1| PREDICTED: two-component response regulator ARR5-like isoform X2 [Erythranthe guttatus] Length = 187 Score = 51.6 bits (122), Expect(2) = 7e-08 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = -2 Query: 367 LSCSVVSAVESGSRALQYLGLDGERSSVEFDVRKV 263 +SC V+AVESG RALQYLGLDGE SSV FD KV Sbjct: 28 VSCCKVTAVESGRRALQYLGLDGETSSVNFDELKV 62 Score = 31.6 bits (70), Expect(2) = 7e-08 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = -1 Query: 194 LLQTIPCMSGMTGYELLKKIKKCS 123 L+ T M GMTGYELLKKIK S Sbjct: 64 LIMTDYSMPGMTGYELLKKIKGSS 87 >gb|AAQ10675.1| type-A response regulator [Catharanthus roseus] Length = 254 Score = 50.8 bits (120), Expect(2) = 2e-07 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -2 Query: 367 LSCSVVSAVESGSRALQYLGLDGERSSVEFDVRKV 263 +SC V+AVESG RALQYLGLDGE+S+V FD KV Sbjct: 35 ISCCKVTAVESGRRALQYLGLDGEKSTVGFDGLKV 69 Score = 31.2 bits (69), Expect(2) = 2e-07 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = -1 Query: 194 LLQTIPCMSGMTGYELLKKIKKCSS 120 L+ T M GMTGYELLKKIK S+ Sbjct: 71 LILTDYSMPGMTGYELLKKIKGSST 95 >ref|XP_008239693.1| PREDICTED: two-component response regulator ARR5-like [Prunus mume] Length = 227 Score = 49.3 bits (116), Expect(2) = 3e-07 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -2 Query: 367 LSCSVVSAVESGSRALQYLGLDGERSSVEFDVRKV 263 +S V+AV+SG+RALQYLGLDGE+SSV FD KV Sbjct: 50 ISSCKVTAVDSGTRALQYLGLDGEKSSVGFDAMKV 84 Score = 32.0 bits (71), Expect(2) = 3e-07 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = -1 Query: 194 LLQTIPCMSGMTGYELLKKIKKCSS 120 L+ T M GMTGYELLKKIK+ S+ Sbjct: 86 LIITDYSMPGMTGYELLKKIKESSA 110 >ref|XP_006344995.1| PREDICTED: two-component response regulator ARR15-like [Solanum tuberosum] Length = 202 Score = 49.3 bits (116), Expect(2) = 3e-07 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -2 Query: 367 LSCSVVSAVESGSRALQYLGLDGERSSVEFDVRKV 263 +SC V+AVESG+RALQYLGLDGE+SS+ D KV Sbjct: 28 ISCCKVTAVESGTRALQYLGLDGEKSSMGIDGLKV 62 Score = 32.0 bits (71), Expect(2) = 3e-07 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -1 Query: 194 LLQTIPCMSGMTGYELLKKIKKCS 123 L+ T M GMTGYELLKKIK+ S Sbjct: 64 LILTDYSMPGMTGYELLKKIKESS 87 >ref|XP_004236156.1| PREDICTED: two-component response regulator ARR15-like [Solanum lycopersicum] Length = 195 Score = 49.3 bits (116), Expect(2) = 3e-07 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -2 Query: 367 LSCSVVSAVESGSRALQYLGLDGERSSVEFDVRKV 263 +SC V+AVESG+RALQYLGLDGE+SS+ D KV Sbjct: 28 ISCCKVTAVESGTRALQYLGLDGEKSSMGIDGLKV 62 Score = 32.0 bits (71), Expect(2) = 3e-07 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -1 Query: 194 LLQTIPCMSGMTGYELLKKIKKCS 123 L+ T M GMTGYELLKKIK+ S Sbjct: 64 LILTDYSMPGMTGYELLKKIKESS 87 >ref|XP_012831141.1| PREDICTED: two-component response regulator ARR5-like isoform X1 [Erythranthe guttatus] Length = 188 Score = 49.7 bits (117), Expect(2) = 3e-07 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -2 Query: 367 LSCSVVSAVESGSRALQYLGLDGERSSVEFD 275 +SC V+AVESG RALQYLGLDGE SSV FD Sbjct: 28 VSCCKVTAVESGRRALQYLGLDGETSSVNFD 58 Score = 31.6 bits (70), Expect(2) = 3e-07 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = -1 Query: 194 LLQTIPCMSGMTGYELLKKIKKCS 123 L+ T M GMTGYELLKKIK S Sbjct: 65 LIMTDYSMPGMTGYELLKKIKGSS 88 >ref|XP_007208910.1| hypothetical protein PRUPE_ppa027113mg, partial [Prunus persica] gi|462404645|gb|EMJ10109.1| hypothetical protein PRUPE_ppa027113mg, partial [Prunus persica] Length = 164 Score = 49.3 bits (116), Expect(2) = 3e-07 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -2 Query: 367 LSCSVVSAVESGSRALQYLGLDGERSSVEFDVRKV 263 +S V+AV+SG+RALQYLGLDGE+SSV FD KV Sbjct: 50 ISSCKVTAVDSGTRALQYLGLDGEKSSVGFDAMKV 84 Score = 32.0 bits (71), Expect(2) = 3e-07 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = -1 Query: 194 LLQTIPCMSGMTGYELLKKIKKCSS 120 L+ T M GMTGYELLKKIK+ S+ Sbjct: 86 LIITDYSMPGMTGYELLKKIKESSA 110 >ref|XP_014496480.1| PREDICTED: two-component response regulator ARR6-like [Vigna radiata var. radiata] Length = 202 Score = 48.1 bits (113), Expect(2) = 3e-07 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = -2 Query: 367 LSCSVVSAVESGSRALQYLGLDGERSSVEFDVRKV 263 +S V+ VESGSRALQYLGLDGE+SS+ FD KV Sbjct: 38 ISSCKVTVVESGSRALQYLGLDGEKSSIGFDSVKV 72 Score = 32.7 bits (73), Expect(2) = 3e-07 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -1 Query: 194 LLQTIPCMSGMTGYELLKKIKKCS 123 L+ T M GMTGYELLKKIK+ S Sbjct: 74 LIMTDYSMPGMTGYELLKKIKESS 97 >gb|KOM40350.1| hypothetical protein LR48_Vigan04g054800 [Vigna angularis] Length = 202 Score = 48.1 bits (113), Expect(2) = 3e-07 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = -2 Query: 367 LSCSVVSAVESGSRALQYLGLDGERSSVEFDVRKV 263 +S V+ VESGSRALQYLGLDGE+SS+ FD KV Sbjct: 38 ISSCKVTVVESGSRALQYLGLDGEKSSIGFDSVKV 72 Score = 32.7 bits (73), Expect(2) = 3e-07 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -1 Query: 194 LLQTIPCMSGMTGYELLKKIKKCS 123 L+ T M GMTGYELLKKIK+ S Sbjct: 74 LIMTDYSMPGMTGYELLKKIKESS 97 >ref|XP_007138131.1| hypothetical protein PHAVU_009G182800g [Phaseolus vulgaris] gi|561011218|gb|ESW10125.1| hypothetical protein PHAVU_009G182800g [Phaseolus vulgaris] Length = 201 Score = 48.1 bits (113), Expect(2) = 3e-07 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = -2 Query: 367 LSCSVVSAVESGSRALQYLGLDGERSSVEFDVRKV 263 +S V+ VESGSRALQYLGLDGE+SS+ FD KV Sbjct: 38 ISSCKVTVVESGSRALQYLGLDGEKSSIGFDSVKV 72 Score = 32.7 bits (73), Expect(2) = 3e-07 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -1 Query: 194 LLQTIPCMSGMTGYELLKKIKKCS 123 L+ T M GMTGYELLKKIK+ S Sbjct: 74 LIMTDYSMPGMTGYELLKKIKESS 97 >ref|XP_006577761.1| PREDICTED: uncharacterized protein LOC100306152 isoform X1 [Glycine max] gi|947115155|gb|KRH63457.1| hypothetical protein GLYMA_04G177900 [Glycine max] Length = 204 Score = 45.8 bits (107), Expect(3) = 4e-07 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = -2 Query: 367 LSCSVVSAVESGSRALQYLGLDGERSSVEFDVRKV 263 +S V+ VESGSRALQYLGLDGE+SS+ D KV Sbjct: 42 ISSCKVTVVESGSRALQYLGLDGEKSSIGLDSVKV 76 Score = 32.7 bits (73), Expect(3) = 4e-07 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -1 Query: 194 LLQTIPCMSGMTGYELLKKIKKCS 123 L+ T M GMTGYELLKKIK+ S Sbjct: 78 LIMTDYSMPGMTGYELLKKIKESS 101 Score = 21.2 bits (43), Expect(3) = 4e-07 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -3 Query: 219 LDSKINDLIITDYSM 175 LDS +LI+TDYSM Sbjct: 71 LDSVKVNLIMTDYSM 85 >ref|NP_001238384.1| uncharacterized protein LOC100306152 [Glycine max] gi|255627697|gb|ACU14193.1| unknown [Glycine max] Length = 201 Score = 45.8 bits (107), Expect(3) = 4e-07 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = -2 Query: 367 LSCSVVSAVESGSRALQYLGLDGERSSVEFDVRKV 263 +S V+ VESGSRALQYLGLDGE+SS+ D KV Sbjct: 42 ISSCKVTVVESGSRALQYLGLDGEKSSIGLDSVKV 76 Score = 32.7 bits (73), Expect(3) = 4e-07 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -1 Query: 194 LLQTIPCMSGMTGYELLKKIKKCS 123 L+ T M GMTGYELLKKIK+ S Sbjct: 78 LIMTDYSMPGMTGYELLKKIKESS 101 Score = 21.2 bits (43), Expect(3) = 4e-07 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -3 Query: 219 LDSKINDLIITDYSM 175 LDS +LI+TDYSM Sbjct: 71 LDSVKVNLIMTDYSM 85 >ref|XP_004299595.1| PREDICTED: two-component response regulator ARR5-like [Fragaria vesca subsp. vesca] Length = 228 Score = 48.5 bits (114), Expect(2) = 4e-07 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 1/36 (2%) Frame = -2 Query: 367 LSCSVVSAVESGSRALQYLGLDGE-RSSVEFDVRKV 263 +SC V+AV+SG+RALQYLGLDGE +SSV FD KV Sbjct: 44 ISCCKVTAVDSGTRALQYLGLDGEKKSSVGFDAMKV 79 Score = 32.0 bits (71), Expect(2) = 4e-07 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = -1 Query: 194 LLQTIPCMSGMTGYELLKKIKKCSS 120 L+ T M GMTGYELLKKIK+ S+ Sbjct: 81 LIITDYSMPGMTGYELLKKIKESSA 105 >ref|XP_011028649.1| PREDICTED: two-component response regulator ARR5-like isoform X1 [Populus euphratica] gi|743850135|ref|XP_011028650.1| PREDICTED: two-component response regulator ARR5-like isoform X1 [Populus euphratica] gi|743850139|ref|XP_011028651.1| PREDICTED: two-component response regulator ARR5-like isoform X1 [Populus euphratica] Length = 229 Score = 46.6 bits (109), Expect(2) = 6e-07 Identities = 23/35 (65%), Positives = 28/35 (80%) Frame = -2 Query: 367 LSCSVVSAVESGSRALQYLGLDGERSSVEFDVRKV 263 +S V+ VESGSRALQYLGLDGE+SSV F+ K+ Sbjct: 55 ISSCKVTVVESGSRALQYLGLDGEKSSVAFNDLKI 89 Score = 33.5 bits (75), Expect(2) = 6e-07 Identities = 17/26 (65%), Positives = 20/26 (76%) Frame = -1 Query: 194 LLQTIPCMSGMTGYELLKKIKKCSSS 117 L+ T M GMTGYELLKKIK+ SS+ Sbjct: 91 LIMTDYSMPGMTGYELLKKIKQESSA 116 >ref|XP_012080154.1| PREDICTED: two-component response regulator ARR5-like [Jatropha curcas] gi|643720897|gb|KDP31161.1| hypothetical protein JCGZ_11537 [Jatropha curcas] Length = 212 Score = 47.0 bits (110), Expect(2) = 6e-07 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -2 Query: 367 LSCSVVSAVESGSRALQYLGLDGERSSVEFDVRKV 263 +S V+AVESG+RALQYLGLDGE+SSV F+ KV Sbjct: 50 ISSCKVTAVESGTRALQYLGLDGEKSSVGFNDLKV 84 Score = 33.1 bits (74), Expect(2) = 6e-07 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = -1 Query: 194 LLQTIPCMSGMTGYELLKKIKKCSS 120 L+ T M GMTGYELLKKIK+ S+ Sbjct: 86 LIMTDYSMPGMTGYELLKKIKESSA 110 >ref|XP_006476689.1| PREDICTED: two-component response regulator ARR15-like [Citrus sinensis] Length = 199 Score = 48.5 bits (114), Expect(2) = 6e-07 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -2 Query: 367 LSCSVVSAVESGSRALQYLGLDGERSSVEFDVRKV 263 +S V+AVESG+RALQYLGLDGE+S+V FD KV Sbjct: 32 ISSCKVTAVESGTRALQYLGLDGEQSNVGFDALKV 66 Score = 31.6 bits (70), Expect(2) = 6e-07 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -1 Query: 194 LLQTIPCMSGMTGYELLKKIKKCS 123 L+ T M GMTGYELLKKIK+ S Sbjct: 68 LIITDYTMPGMTGYELLKKIKESS 91 >ref|XP_006439725.1| hypothetical protein CICLE_v10022334mg [Citrus clementina] gi|557541987|gb|ESR52965.1| hypothetical protein CICLE_v10022334mg [Citrus clementina] Length = 199 Score = 48.5 bits (114), Expect(2) = 6e-07 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -2 Query: 367 LSCSVVSAVESGSRALQYLGLDGERSSVEFDVRKV 263 +S V+AVESG+RALQYLGLDGE+S+V FD KV Sbjct: 32 ISSCKVTAVESGTRALQYLGLDGEQSNVGFDALKV 66 Score = 31.6 bits (70), Expect(2) = 6e-07 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -1 Query: 194 LLQTIPCMSGMTGYELLKKIKKCS 123 L+ T M GMTGYELLKKIK+ S Sbjct: 68 LIITDYTMPGMTGYELLKKIKESS 91 >ref|XP_011028652.1| PREDICTED: two-component response regulator ARR5-like isoform X2 [Populus euphratica] Length = 228 Score = 46.6 bits (109), Expect(2) = 7e-07 Identities = 23/35 (65%), Positives = 28/35 (80%) Frame = -2 Query: 367 LSCSVVSAVESGSRALQYLGLDGERSSVEFDVRKV 263 +S V+ VESGSRALQYLGLDGE+SSV F+ K+ Sbjct: 55 ISSCKVTVVESGSRALQYLGLDGEKSSVAFNDLKI 89 Score = 33.1 bits (74), Expect(2) = 7e-07 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = -1 Query: 194 LLQTIPCMSGMTGYELLKKIKKCSS 120 L+ T M GMTGYELLKKIK+ S+ Sbjct: 91 LIMTDYSMPGMTGYELLKKIKESSA 115 >ref|XP_008374475.1| PREDICTED: two-component response regulator ARR5-like [Malus domestica] Length = 227 Score = 48.1 bits (113), Expect(2) = 7e-07 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -2 Query: 367 LSCSVVSAVESGSRALQYLGLDGERSSVEFDVRKV 263 +S V+AV+SG+RALQYLGLDGE+SSV FD KV Sbjct: 50 ISSCKVTAVDSGTRALQYLGLDGEKSSVGFDNMKV 84 Score = 31.6 bits (70), Expect(2) = 7e-07 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -1 Query: 194 LLQTIPCMSGMTGYELLKKIKKCS 123 L+ T M GMTGYELLKKIK+ S Sbjct: 86 LIITDYSMPGMTGYELLKKIKESS 109