BLASTX nr result
ID: Perilla23_contig00009536
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00009536 (458 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011074751.1| PREDICTED: cellulose synthase A catalytic su... 77 4e-12 ref|XP_011101270.1| PREDICTED: cellulose synthase A catalytic su... 75 1e-11 ref|XP_012839218.1| PREDICTED: cellulose synthase A catalytic su... 75 2e-11 ref|XP_012829515.1| PREDICTED: cellulose synthase A catalytic su... 75 2e-11 ref|XP_009376550.1| PREDICTED: cellulose synthase A catalytic su... 74 3e-11 ref|XP_010241683.1| PREDICTED: cellulose synthase A catalytic su... 74 6e-11 ref|XP_009339472.1| PREDICTED: cellulose synthase A catalytic su... 73 7e-11 ref|XP_008358296.1| PREDICTED: cellulose synthase A catalytic su... 73 7e-11 ref|XP_008381836.1| PREDICTED: cellulose synthase A catalytic su... 73 7e-11 ref|XP_008369157.1| PREDICTED: cellulose synthase A catalytic su... 73 7e-11 ref|XP_009765335.1| PREDICTED: cellulose synthase A catalytic su... 73 9e-11 ref|XP_009599913.1| PREDICTED: cellulose synthase A catalytic su... 73 9e-11 gb|AGV22110.1| cellulose synthase 8 [Betula luminifera] 73 9e-11 ref|XP_012080728.1| PREDICTED: cellulose synthase A catalytic su... 72 1e-10 ref|XP_010063847.1| PREDICTED: cellulose synthase A catalytic su... 72 1e-10 gb|EPS73674.1| cellulose synthase catalytic subunit, partial [Ge... 72 1e-10 ref|XP_004290503.1| PREDICTED: cellulose synthase A catalytic su... 72 1e-10 ref|XP_007199689.1| hypothetical protein PRUPE_ppa000559mg [Prun... 72 1e-10 ref|XP_002265955.1| PREDICTED: cellulose synthase A catalytic su... 72 2e-10 ref|XP_010678670.1| PREDICTED: cellulose synthase A catalytic su... 71 3e-10 >ref|XP_011074751.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Sesamum indicum] Length = 1092 Score = 77.4 bits (189), Expect = 4e-12 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 458 VVWSILLASIFSLLWVRINPFLSRDGIVLEVCGLDCN 348 VVWSILLASIFSLLWVRINPFLSRDGIVLEVCGLDC+ Sbjct: 1056 VVWSILLASIFSLLWVRINPFLSRDGIVLEVCGLDCD 1092 >ref|XP_011101270.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Sesamum indicum] Length = 1084 Score = 75.5 bits (184), Expect = 1e-11 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -1 Query: 458 VVWSILLASIFSLLWVRINPFLSRDGIVLEVCGLDCN 348 VVWSILLASIFSLLWVRINPF+SRDG+VLEVCGLDC+ Sbjct: 1048 VVWSILLASIFSLLWVRINPFVSRDGLVLEVCGLDCD 1084 >ref|XP_012839218.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like [Erythranthe guttatus] gi|604331975|gb|EYU36833.1| hypothetical protein MIMGU_mgv1a000540mg [Erythranthe guttata] Length = 1087 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -1 Query: 458 VVWSILLASIFSLLWVRINPFLSRDGIVLEVCGLDCN 348 +VWSILLASIFSLLWVRINPFL+R GIVLEVCGLDCN Sbjct: 1051 IVWSILLASIFSLLWVRINPFLARGGIVLEVCGLDCN 1087 >ref|XP_012829515.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like [Erythranthe guttatus] gi|604297217|gb|EYU17481.1| hypothetical protein MIMGU_mgv1a000527mg [Erythranthe guttata] Length = 1093 Score = 74.7 bits (182), Expect = 2e-11 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -1 Query: 458 VVWSILLASIFSLLWVRINPFLSRDGIVLEVCGLDCN 348 +VWSILLASIFSLLWVRINPF+SR G+VLEVCGLDCN Sbjct: 1057 IVWSILLASIFSLLWVRINPFVSRGGVVLEVCGLDCN 1093 >ref|XP_009376550.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Pyrus x bretschneideri] Length = 1095 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -1 Query: 458 VVWSILLASIFSLLWVRINPFLSRDGIVLEVCGLDCN 348 VVWSILLASIFSLLWVRINPF+S+ GIVLEVCGLDCN Sbjct: 1059 VVWSILLASIFSLLWVRINPFVSKGGIVLEVCGLDCN 1095 >ref|XP_010241683.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Nelumbo nucifera] Length = 1095 Score = 73.6 bits (179), Expect = 6e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -1 Query: 458 VVWSILLASIFSLLWVRINPFLSRDGIVLEVCGLDCN 348 VVWSILLASIFSLLWVRINPFLS+DG VLEVCGLDC+ Sbjct: 1058 VVWSILLASIFSLLWVRINPFLSKDGPVLEVCGLDCD 1094 >ref|XP_009339472.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Pyrus x bretschneideri] Length = 1095 Score = 73.2 bits (178), Expect = 7e-11 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -1 Query: 458 VVWSILLASIFSLLWVRINPFLSRDGIVLEVCGLDCN 348 VVWSILLASIFSLLWVRINPF+++ GIVLEVCGLDCN Sbjct: 1059 VVWSILLASIFSLLWVRINPFVNKGGIVLEVCGLDCN 1095 >ref|XP_008358296.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Malus domestica] Length = 1095 Score = 73.2 bits (178), Expect = 7e-11 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -1 Query: 458 VVWSILLASIFSLLWVRINPFLSRDGIVLEVCGLDCN 348 VVWSILLASIFSLLWVRINPF+++ GIVLEVCGLDCN Sbjct: 1059 VVWSILLASIFSLLWVRINPFVNKGGIVLEVCGLDCN 1095 >ref|XP_008381836.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Malus domestica] Length = 1095 Score = 73.2 bits (178), Expect = 7e-11 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -1 Query: 458 VVWSILLASIFSLLWVRINPFLSRDGIVLEVCGLDCN 348 VVWSILLASIFSLLWVRINPF+++ GIVLEVCGLDCN Sbjct: 1059 VVWSILLASIFSLLWVRINPFVNKGGIVLEVCGLDCN 1095 >ref|XP_008369157.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Malus domestica] gi|657955385|ref|XP_008369158.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Malus domestica] gi|657955387|ref|XP_008369159.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Malus domestica] Length = 1095 Score = 73.2 bits (178), Expect = 7e-11 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -1 Query: 458 VVWSILLASIFSLLWVRINPFLSRDGIVLEVCGLDCN 348 VVWSILLASIFSLLWVRINPF+++ GIVLEVCGLDCN Sbjct: 1059 VVWSILLASIFSLLWVRINPFVNKGGIVLEVCGLDCN 1095 >ref|XP_009765335.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Nicotiana sylvestris] Length = 1084 Score = 72.8 bits (177), Expect = 9e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 458 VVWSILLASIFSLLWVRINPFLSRDGIVLEVCGLDC 351 VVWSILLASI SLLWVRINPF+SRDG+VLEVCGLDC Sbjct: 1048 VVWSILLASILSLLWVRINPFVSRDGLVLEVCGLDC 1083 >ref|XP_009599913.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Nicotiana tomentosiformis] Length = 1084 Score = 72.8 bits (177), Expect = 9e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 458 VVWSILLASIFSLLWVRINPFLSRDGIVLEVCGLDC 351 VVWSILLASI SLLWVRINPF+SRDG+VLEVCGLDC Sbjct: 1048 VVWSILLASILSLLWVRINPFVSRDGLVLEVCGLDC 1083 >gb|AGV22110.1| cellulose synthase 8 [Betula luminifera] Length = 1091 Score = 72.8 bits (177), Expect = 9e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -1 Query: 458 VVWSILLASIFSLLWVRINPFLSRDGIVLEVCGLDCN 348 VVWSILLASIFSLLWVRINPFLSR GIVLEVCGL+C+ Sbjct: 1055 VVWSILLASIFSLLWVRINPFLSRGGIVLEVCGLNCD 1091 >ref|XP_012080728.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Jatropha curcas] gi|643720354|gb|KDP30751.1| hypothetical protein JCGZ_15180 [Jatropha curcas] Length = 1092 Score = 72.4 bits (176), Expect = 1e-10 Identities = 31/37 (83%), Positives = 37/37 (100%) Frame = -1 Query: 458 VVWSILLASIFSLLWVRINPFLSRDGIVLEVCGLDCN 348 VVW+ILLASIFSLLWVR+NPFLS+DGIVLE+CGL+C+ Sbjct: 1056 VVWAILLASIFSLLWVRVNPFLSKDGIVLEICGLNCD 1092 >ref|XP_010063847.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like [Eucalyptus grandis] gi|629105647|gb|KCW71116.1| hypothetical protein EUGRSUZ_F04216 [Eucalyptus grandis] Length = 1092 Score = 72.4 bits (176), Expect = 1e-10 Identities = 31/37 (83%), Positives = 36/37 (97%) Frame = -1 Query: 458 VVWSILLASIFSLLWVRINPFLSRDGIVLEVCGLDCN 348 +VW+ILLASI +LLWVRINPF+S+DGIVLEVCGLDCN Sbjct: 1056 IVWAILLASILTLLWVRINPFISKDGIVLEVCGLDCN 1092 >gb|EPS73674.1| cellulose synthase catalytic subunit, partial [Genlisea aurea] Length = 522 Score = 72.4 bits (176), Expect = 1e-10 Identities = 31/36 (86%), Positives = 36/36 (100%) Frame = -1 Query: 458 VVWSILLASIFSLLWVRINPFLSRDGIVLEVCGLDC 351 +VW+ILLASIFSLLWVR+NPFLSRDG+VLEVCGL+C Sbjct: 486 IVWTILLASIFSLLWVRVNPFLSRDGLVLEVCGLNC 521 >ref|XP_004290503.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Fragaria vesca subsp. vesca] Length = 1093 Score = 72.4 bits (176), Expect = 1e-10 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -1 Query: 458 VVWSILLASIFSLLWVRINPFLSRDGIVLEVCGLDCN 348 +VWSILLASIFSLLWVRINPF SR GIVLEVCGLDC+ Sbjct: 1057 IVWSILLASIFSLLWVRINPFASRGGIVLEVCGLDCD 1093 >ref|XP_007199689.1| hypothetical protein PRUPE_ppa000559mg [Prunus persica] gi|645264091|ref|XP_008237530.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Prunus mume] gi|462395089|gb|EMJ00888.1| hypothetical protein PRUPE_ppa000559mg [Prunus persica] Length = 1096 Score = 72.4 bits (176), Expect = 1e-10 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -1 Query: 458 VVWSILLASIFSLLWVRINPFLSRDGIVLEVCGLDCN 348 VVWSILLASIFSLLWVRINPF+S+ GIVLEVCGLDC+ Sbjct: 1060 VVWSILLASIFSLLWVRINPFVSKGGIVLEVCGLDCD 1096 >ref|XP_002265955.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] [Vitis vinifera] Length = 1096 Score = 72.0 bits (175), Expect = 2e-10 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -1 Query: 458 VVWSILLASIFSLLWVRINPFLSRDGIVLEVCGLDCN 348 VVWSILLASIFSLLWVR+NPF+S+ GIVLEVCGLDC+ Sbjct: 1060 VVWSILLASIFSLLWVRVNPFVSKGGIVLEVCGLDCD 1096 >ref|XP_010678670.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Beta vulgaris subsp. vulgaris] gi|870859022|gb|KMT10486.1| hypothetical protein BVRB_5g116100 [Beta vulgaris subsp. vulgaris] Length = 1102 Score = 71.2 bits (173), Expect = 3e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -1 Query: 458 VVWSILLASIFSLLWVRINPFLSRDGIVLEVCGLDCN 348 +VWSILLASIFSLLWVRINPF +R GIVLEVCGLDC+ Sbjct: 1066 IVWSILLASIFSLLWVRINPFTARGGIVLEVCGLDCD 1102