BLASTX nr result
ID: Perilla23_contig00008783
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00008783 (369 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010091802.1| hypothetical protein L484_015870 [Morus nota... 56 9e-06 >ref|XP_010091802.1| hypothetical protein L484_015870 [Morus notabilis] gi|587856018|gb|EXB46010.1| hypothetical protein L484_015870 [Morus notabilis] Length = 358 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 272 TKGDLPGAEEYYSRAILVDPEDGDILCQYANV 367 TKGDL GAEEYYSRAIL DP+DGD+L QYA + Sbjct: 259 TKGDLNGAEEYYSRAILADPKDGDVLSQYAKL 290