BLASTX nr result
ID: Perilla23_contig00008674
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00008674 (359 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25628.1| hypothetical protein MIMGU_mgv1a024444mg [Erythra... 57 7e-06 ref|XP_012851483.1| PREDICTED: uncharacterized protein LOC105971... 56 9e-06 >gb|EYU25628.1| hypothetical protein MIMGU_mgv1a024444mg [Erythranthe guttata] Length = 540 Score = 56.6 bits (135), Expect = 7e-06 Identities = 35/59 (59%), Positives = 45/59 (76%), Gaps = 1/59 (1%) Frame = -2 Query: 175 MVLKRQLRQ-GEEGGSELPNKRQHFASNLLKGLNHGRFVQESMSCLEPIIRKMVKESVE 2 MVLKRQLRQ G+E S+ P KR+ + KGLN+GR +QES+S LEP+IRK V+E+VE Sbjct: 1 MVLKRQLRQKGDEDCSD-PAKRRR----ICKGLNYGRTLQESVSYLEPMIRKWVQEAVE 54 >ref|XP_012851483.1| PREDICTED: uncharacterized protein LOC105971177 [Erythranthe guttatus] Length = 599 Score = 56.2 bits (134), Expect = 9e-06 Identities = 31/59 (52%), Positives = 45/59 (76%) Frame = -2 Query: 178 LMVLKRQLRQGEEGGSELPNKRQHFASNLLKGLNHGRFVQESMSCLEPIIRKMVKESVE 2 ++V RQ +G+E S+ P KR+ F S++ KGLN+GR +QES+S LEP+IRK V+E+VE Sbjct: 68 MVVTARQ--KGDEDCSD-PAKRRRFVSDICKGLNYGRTLQESVSYLEPMIRKWVQEAVE 123