BLASTX nr result
ID: Perilla23_contig00008256
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00008256 (342 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011093040.1| PREDICTED: cyclic nucleotide-gated ion chann... 67 5e-09 ref|XP_011093039.1| PREDICTED: cyclic nucleotide-gated ion chann... 66 9e-09 ref|XP_012835642.1| PREDICTED: cyclic nucleotide-gated ion chann... 65 3e-08 gb|EYU38895.1| hypothetical protein MIMGU_mgv1a023022mg, partial... 65 3e-08 ref|XP_011093102.1| PREDICTED: cyclic nucleotide-gated ion chann... 62 1e-07 >ref|XP_011093040.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Sesamum indicum] Length = 717 Score = 67.0 bits (162), Expect = 5e-09 Identities = 35/54 (64%), Positives = 42/54 (77%) Frame = -1 Query: 336 PTMAAAIYASRFATNMIGNLRRSHQYPTNNLMSSPSPKRTTLLPQKPSEPDFSA 175 P++AA +YASRFATNM+GNLRR+H P NN+ SPK LL QKP+EPDFSA Sbjct: 665 PSLAATVYASRFATNMLGNLRRNH--PHNNI---SSPKLPPLLLQKPAEPDFSA 713 >ref|XP_011093039.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Sesamum indicum] Length = 636 Score = 66.2 bits (160), Expect = 9e-09 Identities = 34/54 (62%), Positives = 41/54 (75%) Frame = -1 Query: 336 PTMAAAIYASRFATNMIGNLRRSHQYPTNNLMSSPSPKRTTLLPQKPSEPDFSA 175 P++AA +YASRFATNM+GNLRR+H P N + PSPK LL KP+EPDFSA Sbjct: 584 PSLAATVYASRFATNMLGNLRRNH--PRNTI---PSPKLPPLLLHKPAEPDFSA 632 >ref|XP_012835642.1| PREDICTED: cyclic nucleotide-gated ion channel 1 [Erythranthe guttatus] Length = 714 Score = 64.7 bits (156), Expect = 3e-08 Identities = 33/55 (60%), Positives = 42/55 (76%) Frame = -1 Query: 342 NAPTMAAAIYASRFATNMIGNLRRSHQYPTNNLMSSPSPKRTTLLPQKPSEPDFS 178 ++P++ AA+YAS+FATNM+ NLRR NN+ PSPK TLLPQKP+EPDFS Sbjct: 664 DSPSIGAAVYASKFATNMLANLRR------NNI---PSPKLPTLLPQKPAEPDFS 709 >gb|EYU38895.1| hypothetical protein MIMGU_mgv1a023022mg, partial [Erythranthe guttata] Length = 703 Score = 64.7 bits (156), Expect = 3e-08 Identities = 33/55 (60%), Positives = 42/55 (76%) Frame = -1 Query: 342 NAPTMAAAIYASRFATNMIGNLRRSHQYPTNNLMSSPSPKRTTLLPQKPSEPDFS 178 ++P++ AA+YAS+FATNM+ NLRR NN+ PSPK TLLPQKP+EPDFS Sbjct: 653 DSPSIGAAVYASKFATNMLANLRR------NNI---PSPKLPTLLPQKPAEPDFS 698 >ref|XP_011093102.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Sesamum indicum] Length = 602 Score = 62.4 bits (150), Expect = 1e-07 Identities = 33/55 (60%), Positives = 42/55 (76%) Frame = -1 Query: 336 PTMAAAIYASRFATNMIGNLRRSHQYPTNNLMSSPSPKRTTLLPQKPSEPDFSAG 172 P++AA +YASRFATNM+GNLR +H N++S SP+ LL QKP+EPDFSAG Sbjct: 550 PSLAATVYASRFATNMLGNLRCNH---PRNIIS--SPRLPPLLFQKPAEPDFSAG 599