BLASTX nr result
ID: Perilla23_contig00007603
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00007603 (506 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098260.1| PREDICTED: uncharacterized protein LOC105176... 61 3e-07 ref|XP_011098252.1| PREDICTED: uncharacterized protein LOC105176... 61 3e-07 gb|KJB18201.1| hypothetical protein B456_003G038800 [Gossypium r... 61 4e-07 ref|XP_012469776.1| PREDICTED: uncharacterized protein LOC105787... 61 4e-07 gb|KHG01276.1| Tetratricopeptide repeat 1 [Gossypium arboreum] 61 4e-07 ref|XP_012092082.1| PREDICTED: uncharacterized protein LOC105649... 60 8e-07 ref|XP_011031003.1| PREDICTED: uncharacterized protein LOC105130... 60 8e-07 ref|XP_011031002.1| PREDICTED: uncharacterized protein LOC105130... 60 8e-07 ref|XP_011022785.1| PREDICTED: uncharacterized protein LOC105124... 60 8e-07 ref|XP_011022784.1| PREDICTED: uncharacterized protein LOC105124... 60 8e-07 ref|XP_012091974.1| PREDICTED: uncharacterized protein LOC105649... 60 8e-07 ref|XP_002533208.1| heat shock protein 70 (HSP70)-interacting pr... 60 8e-07 ref|XP_002307091.1| hypothetical protein POPTR_0005s07790g [Popu... 60 8e-07 ref|XP_006380423.1| hypothetical protein POPTR_0007s05550g [Popu... 60 8e-07 ref|XP_007047977.1| ARM-repeat/Tetratricopeptide repeat (TPR)-li... 60 8e-07 ref|XP_007047976.1| ARM-repeat/Tetratricopeptide repeat (TPR)-li... 60 8e-07 emb|CAN77716.1| hypothetical protein VITISV_023407 [Vitis vinifera] 60 8e-07 ref|XP_006355353.1| PREDICTED: uncharacterized protein LOC102588... 59 1e-06 ref|XP_004237397.1| PREDICTED: uncharacterized protein LOC101261... 59 1e-06 ref|XP_011074135.1| PREDICTED: uncharacterized protein LOC105158... 59 2e-06 >ref|XP_011098260.1| PREDICTED: uncharacterized protein LOC105176954 isoform X2 [Sesamum indicum] Length = 619 Score = 61.2 bits (147), Expect = 3e-07 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 80 SMDKGSPDCPYPGCFFCVMKEGNPSK 3 SMDK SPDCPYPGCFFCVMKEGNPSK Sbjct: 2 SMDKVSPDCPYPGCFFCVMKEGNPSK 27 >ref|XP_011098252.1| PREDICTED: uncharacterized protein LOC105176954 isoform X1 [Sesamum indicum] Length = 623 Score = 61.2 bits (147), Expect = 3e-07 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 80 SMDKGSPDCPYPGCFFCVMKEGNPSK 3 SMDK SPDCPYPGCFFCVMKEGNPSK Sbjct: 2 SMDKVSPDCPYPGCFFCVMKEGNPSK 27 >gb|KJB18201.1| hypothetical protein B456_003G038800 [Gossypium raimondii] Length = 621 Score = 60.8 bits (146), Expect = 4e-07 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -1 Query: 77 MDKGSPDCPYPGCFFCVMKEGNPSK 3 MDK SPDCPYPGCFFCVMKEGNPSK Sbjct: 1 MDKASPDCPYPGCFFCVMKEGNPSK 25 >ref|XP_012469776.1| PREDICTED: uncharacterized protein LOC105787764 [Gossypium raimondii] gi|763750812|gb|KJB18200.1| hypothetical protein B456_003G038800 [Gossypium raimondii] Length = 630 Score = 60.8 bits (146), Expect = 4e-07 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -1 Query: 77 MDKGSPDCPYPGCFFCVMKEGNPSK 3 MDK SPDCPYPGCFFCVMKEGNPSK Sbjct: 1 MDKASPDCPYPGCFFCVMKEGNPSK 25 >gb|KHG01276.1| Tetratricopeptide repeat 1 [Gossypium arboreum] Length = 630 Score = 60.8 bits (146), Expect = 4e-07 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -1 Query: 77 MDKGSPDCPYPGCFFCVMKEGNPSK 3 MDK SPDCPYPGCFFCVMKEGNPSK Sbjct: 1 MDKASPDCPYPGCFFCVMKEGNPSK 25 >ref|XP_012092082.1| PREDICTED: uncharacterized protein LOC105649774 isoform X2 [Jatropha curcas] Length = 618 Score = 59.7 bits (143), Expect = 8e-07 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -1 Query: 77 MDKGSPDCPYPGCFFCVMKEGNPSK 3 MDK SPDCPYPGCFFCVMKEGNPSK Sbjct: 1 MDKVSPDCPYPGCFFCVMKEGNPSK 25 >ref|XP_011031003.1| PREDICTED: uncharacterized protein LOC105130276 isoform X2 [Populus euphratica] gi|743860962|ref|XP_011031004.1| PREDICTED: uncharacterized protein LOC105130276 isoform X3 [Populus euphratica] Length = 630 Score = 59.7 bits (143), Expect = 8e-07 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -1 Query: 77 MDKGSPDCPYPGCFFCVMKEGNPSK 3 MDK SPDCPYPGCFFCVMKEGNPSK Sbjct: 1 MDKVSPDCPYPGCFFCVMKEGNPSK 25 >ref|XP_011031002.1| PREDICTED: uncharacterized protein LOC105130276 isoform X1 [Populus euphratica] Length = 631 Score = 59.7 bits (143), Expect = 8e-07 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -1 Query: 77 MDKGSPDCPYPGCFFCVMKEGNPSK 3 MDK SPDCPYPGCFFCVMKEGNPSK Sbjct: 1 MDKVSPDCPYPGCFFCVMKEGNPSK 25 >ref|XP_011022785.1| PREDICTED: uncharacterized protein LOC105124457 isoform X2 [Populus euphratica] Length = 619 Score = 59.7 bits (143), Expect = 8e-07 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -1 Query: 77 MDKGSPDCPYPGCFFCVMKEGNPSK 3 MDK SPDCPYPGCFFCVMKEGNPSK Sbjct: 1 MDKVSPDCPYPGCFFCVMKEGNPSK 25 >ref|XP_011022784.1| PREDICTED: uncharacterized protein LOC105124457 isoform X1 [Populus euphratica] Length = 630 Score = 59.7 bits (143), Expect = 8e-07 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -1 Query: 77 MDKGSPDCPYPGCFFCVMKEGNPSK 3 MDK SPDCPYPGCFFCVMKEGNPSK Sbjct: 1 MDKVSPDCPYPGCFFCVMKEGNPSK 25 >ref|XP_012091974.1| PREDICTED: uncharacterized protein LOC105649774 isoform X1 [Jatropha curcas] gi|643741372|gb|KDP46848.1| hypothetical protein JCGZ_24057 [Jatropha curcas] Length = 629 Score = 59.7 bits (143), Expect = 8e-07 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -1 Query: 77 MDKGSPDCPYPGCFFCVMKEGNPSK 3 MDK SPDCPYPGCFFCVMKEGNPSK Sbjct: 1 MDKVSPDCPYPGCFFCVMKEGNPSK 25 >ref|XP_002533208.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus communis] gi|223526984|gb|EEF29179.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus communis] Length = 627 Score = 59.7 bits (143), Expect = 8e-07 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -1 Query: 77 MDKGSPDCPYPGCFFCVMKEGNPSK 3 MDK SPDCPYPGCFFCVMKEGNPSK Sbjct: 1 MDKVSPDCPYPGCFFCVMKEGNPSK 25 >ref|XP_002307091.1| hypothetical protein POPTR_0005s07790g [Populus trichocarpa] gi|222856540|gb|EEE94087.1| hypothetical protein POPTR_0005s07790g [Populus trichocarpa] Length = 618 Score = 59.7 bits (143), Expect = 8e-07 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -1 Query: 77 MDKGSPDCPYPGCFFCVMKEGNPSK 3 MDK SPDCPYPGCFFCVMKEGNPSK Sbjct: 1 MDKVSPDCPYPGCFFCVMKEGNPSK 25 >ref|XP_006380423.1| hypothetical protein POPTR_0007s05550g [Populus trichocarpa] gi|550334192|gb|ERP58220.1| hypothetical protein POPTR_0007s05550g [Populus trichocarpa] Length = 630 Score = 59.7 bits (143), Expect = 8e-07 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -1 Query: 77 MDKGSPDCPYPGCFFCVMKEGNPSK 3 MDK SPDCPYPGCFFCVMKEGNPSK Sbjct: 1 MDKVSPDCPYPGCFFCVMKEGNPSK 25 >ref|XP_007047977.1| ARM-repeat/Tetratricopeptide repeat (TPR)-like protein isoform 2 [Theobroma cacao] gi|508700238|gb|EOX92134.1| ARM-repeat/Tetratricopeptide repeat (TPR)-like protein isoform 2 [Theobroma cacao] Length = 621 Score = 59.7 bits (143), Expect = 8e-07 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -1 Query: 77 MDKGSPDCPYPGCFFCVMKEGNPSK 3 MDK SPDCPYPGCFFCVMKEGNPSK Sbjct: 1 MDKVSPDCPYPGCFFCVMKEGNPSK 25 >ref|XP_007047976.1| ARM-repeat/Tetratricopeptide repeat (TPR)-like protein isoform 1 [Theobroma cacao] gi|508700237|gb|EOX92133.1| ARM-repeat/Tetratricopeptide repeat (TPR)-like protein isoform 1 [Theobroma cacao] Length = 630 Score = 59.7 bits (143), Expect = 8e-07 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -1 Query: 77 MDKGSPDCPYPGCFFCVMKEGNPSK 3 MDK SPDCPYPGCFFCVMKEGNPSK Sbjct: 1 MDKVSPDCPYPGCFFCVMKEGNPSK 25 >emb|CAN77716.1| hypothetical protein VITISV_023407 [Vitis vinifera] Length = 635 Score = 59.7 bits (143), Expect = 8e-07 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -1 Query: 77 MDKGSPDCPYPGCFFCVMKEGNPSK 3 MDK SPDCPYPGCFFCVMKEGNPSK Sbjct: 1 MDKVSPDCPYPGCFFCVMKEGNPSK 25 >ref|XP_006355353.1| PREDICTED: uncharacterized protein LOC102588167 [Solanum tuberosum] Length = 629 Score = 59.3 bits (142), Expect = 1e-06 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = -1 Query: 80 SMDKGSPDCPYPGCFFCVMKEGNPSK 3 SMDK S DCPYPGCFFCVMKEGNPSK Sbjct: 2 SMDKASADCPYPGCFFCVMKEGNPSK 27 >ref|XP_004237397.1| PREDICTED: uncharacterized protein LOC101261016 [Solanum lycopersicum] Length = 629 Score = 59.3 bits (142), Expect = 1e-06 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = -1 Query: 80 SMDKGSPDCPYPGCFFCVMKEGNPSK 3 SMDK S DCPYPGCFFCVMKEGNPSK Sbjct: 2 SMDKASADCPYPGCFFCVMKEGNPSK 27 >ref|XP_011074135.1| PREDICTED: uncharacterized protein LOC105158920 isoform X1 [Sesamum indicum] Length = 718 Score = 58.5 bits (140), Expect = 2e-06 Identities = 35/62 (56%), Positives = 39/62 (62%), Gaps = 3/62 (4%) Frame = -1 Query: 179 CVHCFLVQDSVSNKSFR*LLFEELVTTCVK---VKSSMDKGSPDCPYPGCFFCVMKEGNP 9 CVH + +V K F+ L EELVT + SMDK PDCPYPGCFFCVMKE NP Sbjct: 58 CVHFSFSRLAVLQK-FK--LDEELVTWFSGYEVILMSMDKVLPDCPYPGCFFCVMKEANP 114 Query: 8 SK 3 SK Sbjct: 115 SK 116