BLASTX nr result
ID: Perilla23_contig00006120
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00006120 (318 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001149847.1| peptidyl-prolyl cis-trans isomerase CYP19-4 ... 71 4e-10 gb|ACF87276.1| unknown [Zea mays] 71 4e-10 gb|AFW69420.1| putative peptidyl-prolyl cis-trans isomerase fami... 71 4e-10 gb|KQL12150.1| hypothetical protein SETIT_007261mg [Setaria ital... 70 6e-10 gb|KQL12149.1| hypothetical protein SETIT_007261mg [Setaria ital... 70 6e-10 ref|XP_004966389.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 70 6e-10 ref|XP_004966388.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 70 6e-10 ref|XP_014518900.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 69 1e-09 gb|KJB34588.1| hypothetical protein B456_006G106600 [Gossypium r... 69 1e-09 ref|XP_012485024.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 69 1e-09 gb|KHG08655.1| Peptidyl-prolyl cis-trans isomerase CYP20-1 -like... 69 1e-09 gb|KCW85440.1| hypothetical protein EUGRSUZ_B02252 [Eucalyptus g... 69 1e-09 ref|XP_010043430.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 69 1e-09 gb|KOM52590.1| hypothetical protein LR48_Vigan09g124900 [Vigna a... 69 1e-09 ref|XP_009773253.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 69 1e-09 gb|AFN53672.1| peptidyl-prolyl cis-trans isomerase [Linum usitat... 69 1e-09 ref|XP_011080792.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 69 2e-09 ref|XP_007146769.1| hypothetical protein PHAVU_006G068200g [Phas... 69 2e-09 gb|EPS66571.1| peptidyl-prolyl cis-trans isomerase, partial [Gen... 69 2e-09 ref|NP_001058535.1| Os06g0708500 [Oryza sativa Japonica Group] g... 68 2e-09 >ref|NP_001149847.1| peptidyl-prolyl cis-trans isomerase CYP19-4 precursor [Zea mays] gi|195635023|gb|ACG36980.1| peptidyl-prolyl cis-trans isomerase CYP19-4 precursor [Zea mays] gi|413934868|gb|AFW69419.1| putative peptidyl-prolyl cis-trans isomerase family protein [Zea mays] Length = 215 Score = 70.9 bits (172), Expect = 4e-10 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +1 Query: 1 GKVLSGMDVVYKVEAEGKQSGEPKRKVVIADSGELPL 111 GKVLSGMDVVYKVEAEG+QSGEPK KVVIADSGELP+ Sbjct: 179 GKVLSGMDVVYKVEAEGRQSGEPKSKVVIADSGELPM 215 >gb|ACF87276.1| unknown [Zea mays] Length = 106 Score = 70.9 bits (172), Expect = 4e-10 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +1 Query: 1 GKVLSGMDVVYKVEAEGKQSGEPKRKVVIADSGELPL 111 GKVLSGMDVVYKVEAEG+QSGEPK KVVIADSGELP+ Sbjct: 70 GKVLSGMDVVYKVEAEGRQSGEPKSKVVIADSGELPM 106 >gb|AFW69420.1| putative peptidyl-prolyl cis-trans isomerase family protein [Zea mays] Length = 220 Score = 70.9 bits (172), Expect = 4e-10 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +1 Query: 1 GKVLSGMDVVYKVEAEGKQSGEPKRKVVIADSGELPL 111 GKVLSGMDVVYKVEAEG+QSGEPK KVVIADSGELP+ Sbjct: 184 GKVLSGMDVVYKVEAEGRQSGEPKSKVVIADSGELPM 220 >gb|KQL12150.1| hypothetical protein SETIT_007261mg [Setaria italica] Length = 152 Score = 70.1 bits (170), Expect = 6e-10 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +1 Query: 1 GKVLSGMDVVYKVEAEGKQSGEPKRKVVIADSGELPL 111 GKVLSGMDVVYKVEAEG+QSG+PK KV+IADSGELPL Sbjct: 116 GKVLSGMDVVYKVEAEGRQSGQPKSKVIIADSGELPL 152 >gb|KQL12149.1| hypothetical protein SETIT_007261mg [Setaria italica] Length = 214 Score = 70.1 bits (170), Expect = 6e-10 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +1 Query: 1 GKVLSGMDVVYKVEAEGKQSGEPKRKVVIADSGELPL 111 GKVLSGMDVVYKVEAEG+QSG+PK KV+IADSGELPL Sbjct: 178 GKVLSGMDVVYKVEAEGRQSGQPKSKVIIADSGELPL 214 >ref|XP_004966389.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4-like isoform X2 [Setaria italica] gi|944247854|gb|KQL12148.1| hypothetical protein SETIT_007261mg [Setaria italica] Length = 215 Score = 70.1 bits (170), Expect = 6e-10 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +1 Query: 1 GKVLSGMDVVYKVEAEGKQSGEPKRKVVIADSGELPL 111 GKVLSGMDVVYKVEAEG+QSG+PK KV+IADSGELPL Sbjct: 179 GKVLSGMDVVYKVEAEGRQSGQPKSKVIIADSGELPL 215 >ref|XP_004966388.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4-like isoform X1 [Setaria italica] Length = 220 Score = 70.1 bits (170), Expect = 6e-10 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +1 Query: 1 GKVLSGMDVVYKVEAEGKQSGEPKRKVVIADSGELPL 111 GKVLSGMDVVYKVEAEG+QSG+PK KV+IADSGELPL Sbjct: 184 GKVLSGMDVVYKVEAEGRQSGQPKSKVIIADSGELPL 220 >ref|XP_014518900.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4 [Vigna radiata var. radiata] Length = 204 Score = 69.3 bits (168), Expect = 1e-09 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +1 Query: 1 GKVLSGMDVVYKVEAEGKQSGEPKRKVVIADSGELPL 111 GKVLSGMDVVYKVEAEG+QSG PK KVVIADSGELPL Sbjct: 168 GKVLSGMDVVYKVEAEGRQSGTPKSKVVIADSGELPL 204 >gb|KJB34588.1| hypothetical protein B456_006G106600 [Gossypium raimondii] Length = 266 Score = 69.3 bits (168), Expect = 1e-09 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +1 Query: 1 GKVLSGMDVVYKVEAEGKQSGEPKRKVVIADSGELPL 111 GKVLSGMDVVYKVEAEG+QSG PK KVVIADSGELPL Sbjct: 171 GKVLSGMDVVYKVEAEGRQSGTPKSKVVIADSGELPL 207 >ref|XP_012485024.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4-like [Gossypium raimondii] gi|763767372|gb|KJB34587.1| hypothetical protein B456_006G106600 [Gossypium raimondii] Length = 207 Score = 69.3 bits (168), Expect = 1e-09 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +1 Query: 1 GKVLSGMDVVYKVEAEGKQSGEPKRKVVIADSGELPL 111 GKVLSGMDVVYKVEAEG+QSG PK KVVIADSGELPL Sbjct: 171 GKVLSGMDVVYKVEAEGRQSGTPKSKVVIADSGELPL 207 >gb|KHG08655.1| Peptidyl-prolyl cis-trans isomerase CYP20-1 -like protein [Gossypium arboreum] Length = 207 Score = 69.3 bits (168), Expect = 1e-09 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +1 Query: 1 GKVLSGMDVVYKVEAEGKQSGEPKRKVVIADSGELPL 111 GKVLSGMDVVYKVEAEG+QSG PK KVVIADSGELPL Sbjct: 171 GKVLSGMDVVYKVEAEGRQSGTPKSKVVIADSGELPL 207 >gb|KCW85440.1| hypothetical protein EUGRSUZ_B02252 [Eucalyptus grandis] Length = 152 Score = 69.3 bits (168), Expect = 1e-09 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +1 Query: 1 GKVLSGMDVVYKVEAEGKQSGEPKRKVVIADSGELPL 111 GKVLSGMDVVYKVEAEG+QSG PK KVVIADSGELPL Sbjct: 116 GKVLSGMDVVYKVEAEGRQSGTPKSKVVIADSGELPL 152 >ref|XP_010043430.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Eucalyptus grandis] gi|629120948|gb|KCW85438.1| hypothetical protein EUGRSUZ_B02252 [Eucalyptus grandis] Length = 203 Score = 69.3 bits (168), Expect = 1e-09 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +1 Query: 1 GKVLSGMDVVYKVEAEGKQSGEPKRKVVIADSGELPL 111 GKVLSGMDVVYKVEAEG+QSG PK KVVIADSGELPL Sbjct: 167 GKVLSGMDVVYKVEAEGRQSGTPKSKVVIADSGELPL 203 >gb|KOM52590.1| hypothetical protein LR48_Vigan09g124900 [Vigna angularis] Length = 806 Score = 68.9 bits (167), Expect = 1e-09 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +1 Query: 1 GKVLSGMDVVYKVEAEGKQSGEPKRKVVIADSGELPL 111 GKVLSGMDVVYKVEAEG+QSG PK KVV+ADSGELPL Sbjct: 770 GKVLSGMDVVYKVEAEGRQSGTPKSKVVVADSGELPL 806 >ref|XP_009773253.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1 [Nicotiana sylvestris] Length = 206 Score = 68.9 bits (167), Expect = 1e-09 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +1 Query: 1 GKVLSGMDVVYKVEAEGKQSGEPKRKVVIADSGELPL 111 GKVLSGMDVVYK+EAEG+QSG PK KVVIADSGELPL Sbjct: 170 GKVLSGMDVVYKIEAEGRQSGTPKSKVVIADSGELPL 206 >gb|AFN53672.1| peptidyl-prolyl cis-trans isomerase [Linum usitatissimum] Length = 206 Score = 68.9 bits (167), Expect = 1e-09 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = +1 Query: 1 GKVLSGMDVVYKVEAEGKQSGEPKRKVVIADSGELPL 111 GKVLSGMDVVYKVEAEGKQSG PK KVVI DSGELPL Sbjct: 170 GKVLSGMDVVYKVEAEGKQSGTPKSKVVIVDSGELPL 206 >ref|XP_011080792.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Sesamum indicum] Length = 205 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = +1 Query: 1 GKVLSGMDVVYKVEAEGKQSGEPKRKVVIADSGELPL 111 GKVLSGMDVVYK+EAEGKQSG PK KVVI DSGELPL Sbjct: 169 GKVLSGMDVVYKIEAEGKQSGTPKSKVVIVDSGELPL 205 >ref|XP_007146769.1| hypothetical protein PHAVU_006G068200g [Phaseolus vulgaris] gi|561019992|gb|ESW18763.1| hypothetical protein PHAVU_006G068200g [Phaseolus vulgaris] Length = 204 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +1 Query: 1 GKVLSGMDVVYKVEAEGKQSGEPKRKVVIADSGELPL 111 GKV+SGMDVVYKVEAEG+QSG PK KVVIADSGELPL Sbjct: 168 GKVISGMDVVYKVEAEGRQSGTPKSKVVIADSGELPL 204 >gb|EPS66571.1| peptidyl-prolyl cis-trans isomerase, partial [Genlisea aurea] Length = 184 Score = 68.6 bits (166), Expect = 2e-09 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 1 GKVLSGMDVVYKVEAEGKQSGEPKRKVVIADSGELPL 111 GKV+SGMDVVYK+EAEGKQSG PK KVVIADSGELP+ Sbjct: 148 GKVISGMDVVYKIEAEGKQSGTPKSKVVIADSGELPM 184 >ref|NP_001058535.1| Os06g0708500 [Oryza sativa Japonica Group] gi|53792607|dbj|BAD53622.1| putative cyclophilin [Oryza sativa Japonica Group] gi|53792614|dbj|BAD53628.1| putative cyclophilin [Oryza sativa Japonica Group] gi|113596575|dbj|BAF20449.1| Os06g0708500 [Oryza sativa Japonica Group] gi|215704155|dbj|BAG92995.1| unnamed protein product [Oryza sativa Japonica Group] gi|937924517|dbj|BAS99434.1| Os06g0708500 [Oryza sativa Japonica Group] Length = 220 Score = 68.2 bits (165), Expect = 2e-09 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 1 GKVLSGMDVVYKVEAEGKQSGEPKRKVVIADSGELPL 111 GKVLSGMDVVYK+EAEG+QSG PK KVVIADSGELP+ Sbjct: 184 GKVLSGMDVVYKIEAEGQQSGSPKSKVVIADSGELPM 220