BLASTX nr result
ID: Perilla23_contig00005549
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00005549 (670 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS72547.1| hypothetical protein M569_02207, partial [Genlise... 57 8e-06 >gb|EPS72547.1| hypothetical protein M569_02207, partial [Genlisea aurea] Length = 394 Score = 57.4 bits (137), Expect = 8e-06 Identities = 27/43 (62%), Positives = 28/43 (65%) Frame = -2 Query: 669 LRKSLKKCIWNCTPSPPRDPNENSXXXXXXXXXXXXEKPNKGL 541 LRK+LK CIWNCTPSPPRDPNE S EKP KGL Sbjct: 36 LRKALKNCIWNCTPSPPRDPNEKSDGEPEENFDVEAEKPIKGL 78