BLASTX nr result
ID: Perilla23_contig00001991
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00001991 (367 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013606110.1| PREDICTED: 26S protease regulatory subunit 6... 99 1e-18 ref|XP_010553185.1| PREDICTED: 26S protease regulatory subunit 6... 99 1e-18 ref|XP_010541475.1| PREDICTED: 26S protease regulatory subunit 6... 99 1e-18 ref|XP_009120337.1| PREDICTED: 26S protease regulatory subunit 6... 99 1e-18 ref|XP_009132068.1| PREDICTED: 26S protease regulatory subunit 6... 99 1e-18 ref|XP_013621673.1| PREDICTED: 26S protease regulatory subunit 6... 99 1e-18 ref|XP_009126768.1| PREDICTED: 26S protease regulatory subunit 6... 99 1e-18 emb|CDY32995.1| BnaA10g12010D [Brassica napus] 99 1e-18 ref|XP_013622006.1| PREDICTED: 26S protease regulatory subunit 6... 99 1e-18 emb|CDY43865.1| BnaC09g33780D [Brassica napus] 99 1e-18 ref|XP_013732070.1| PREDICTED: 26S protease regulatory subunit 6... 99 1e-18 gb|KFK27360.1| hypothetical protein AALP_AA8G372700 [Arabis alpina] 99 1e-18 ref|XP_014518663.1| PREDICTED: 26S protease regulatory subunit 6... 98 3e-18 gb|KOM52733.1| hypothetical protein LR48_Vigan09g139200 [Vigna a... 98 3e-18 ref|NP_200637.1| regulatory particle triple-A ATPase 3 [Arabidop... 98 3e-18 ref|XP_012486311.1| PREDICTED: 26S protease regulatory subunit 6... 98 3e-18 ref|XP_011040698.1| PREDICTED: 26S protease regulatory subunit 6... 98 3e-18 gb|KHN18648.1| 26S protease regulatory subunit 6B like [Glycine ... 98 3e-18 gb|KHG28345.1| 26S protease regulatory subunit 6B -like protein ... 98 3e-18 gb|KHG22968.1| 26S protease regulatory subunit 6B -like protein ... 98 3e-18 >ref|XP_013606110.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Brassica oleracea var. oleracea] Length = 404 Score = 99.0 bits (245), Expect = 1e-18 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -1 Query: 367 AAEIAAICQEAGLHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 227 AAEIAAICQEAG+HAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK Sbjct: 358 AAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 404 >ref|XP_010553185.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Tarenaya hassleriana] Length = 404 Score = 99.0 bits (245), Expect = 1e-18 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -1 Query: 367 AAEIAAICQEAGLHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 227 AAEIAAICQEAG+HAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK Sbjct: 358 AAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 404 >ref|XP_010541475.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Tarenaya hassleriana] Length = 405 Score = 99.0 bits (245), Expect = 1e-18 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -1 Query: 367 AAEIAAICQEAGLHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 227 AAEIAAICQEAG+HAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK Sbjct: 359 AAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 405 >ref|XP_009120337.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Brassica rapa] gi|923891473|ref|XP_013716802.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Brassica napus] Length = 404 Score = 99.0 bits (245), Expect = 1e-18 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -1 Query: 367 AAEIAAICQEAGLHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 227 AAEIAAICQEAG+HAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK Sbjct: 358 AAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 404 >ref|XP_009132068.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Brassica rapa] Length = 404 Score = 99.0 bits (245), Expect = 1e-18 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -1 Query: 367 AAEIAAICQEAGLHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 227 AAEIAAICQEAG+HAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK Sbjct: 358 AAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 404 >ref|XP_013621673.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Brassica oleracea var. oleracea] gi|923526256|ref|XP_013683742.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Brassica napus] gi|674930545|emb|CDY02806.1| BnaC02g10830D [Brassica napus] Length = 404 Score = 99.0 bits (245), Expect = 1e-18 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -1 Query: 367 AAEIAAICQEAGLHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 227 AAEIAAICQEAG+HAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK Sbjct: 358 AAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 404 >ref|XP_009126768.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Brassica rapa] gi|923526006|ref|XP_013682928.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Brassica napus] gi|674900274|emb|CDY32714.1| BnaA02g07760D [Brassica napus] Length = 404 Score = 99.0 bits (245), Expect = 1e-18 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -1 Query: 367 AAEIAAICQEAGLHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 227 AAEIAAICQEAG+HAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK Sbjct: 358 AAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 404 >emb|CDY32995.1| BnaA10g12010D [Brassica napus] Length = 404 Score = 99.0 bits (245), Expect = 1e-18 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -1 Query: 367 AAEIAAICQEAGLHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 227 AAEIAAICQEAG+HAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK Sbjct: 358 AAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 404 >ref|XP_013622006.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Brassica oleracea var. oleracea] gi|674874656|emb|CDY58566.1| BnaC03g12460D [Brassica napus] Length = 404 Score = 99.0 bits (245), Expect = 1e-18 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -1 Query: 367 AAEIAAICQEAGLHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 227 AAEIAAICQEAG+HAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK Sbjct: 358 AAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 404 >emb|CDY43865.1| BnaC09g33780D [Brassica napus] Length = 404 Score = 99.0 bits (245), Expect = 1e-18 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -1 Query: 367 AAEIAAICQEAGLHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 227 AAEIAAICQEAG+HAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK Sbjct: 358 AAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 404 >ref|XP_013732070.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Brassica napus] gi|923783127|ref|XP_013682434.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Brassica napus] gi|674944599|emb|CDX88666.1| BnaA03g09830D [Brassica napus] Length = 404 Score = 99.0 bits (245), Expect = 1e-18 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -1 Query: 367 AAEIAAICQEAGLHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 227 AAEIAAICQEAG+HAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK Sbjct: 358 AAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 404 >gb|KFK27360.1| hypothetical protein AALP_AA8G372700 [Arabis alpina] Length = 404 Score = 99.0 bits (245), Expect = 1e-18 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -1 Query: 367 AAEIAAICQEAGLHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 227 AAEIAAICQEAG+HAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK Sbjct: 358 AAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 404 >ref|XP_014518663.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Vigna radiata var. radiata] Length = 420 Score = 97.8 bits (242), Expect = 3e-18 Identities = 45/47 (95%), Positives = 47/47 (100%) Frame = -1 Query: 367 AAEIAAICQEAGLHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 227 AAEIAAICQEAG+HAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFYK Sbjct: 374 AAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 420 >gb|KOM52733.1| hypothetical protein LR48_Vigan09g139200 [Vigna angularis] Length = 417 Score = 97.8 bits (242), Expect = 3e-18 Identities = 45/47 (95%), Positives = 47/47 (100%) Frame = -1 Query: 367 AAEIAAICQEAGLHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 227 AAEIAAICQEAG+HAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFYK Sbjct: 371 AAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 417 >ref|NP_200637.1| regulatory particle triple-A ATPase 3 [Arabidopsis thaliana] gi|297793353|ref|XP_002864561.1| hypothetical protein ARALYDRAFT_495939 [Arabidopsis lyrata subsp. lyrata] gi|565430379|ref|XP_006279634.1| hypothetical protein CARUB_v10026512mg [Capsella rubella] gi|28558168|sp|Q9SEI4.1|PRS6B_ARATH RecName: Full=26S protease regulatory subunit 6B homolog; AltName: Full=26S protease subunit 6B homolog; AltName: Full=26S proteasome AAA-ATPase subunit RPT3; AltName: Full=Protein BMAA insensitive morphology 409; AltName: Full=Regulatory particle triple-A ATPase subunit 3 gi|6652882|gb|AAF22523.1|AF123392_1 26S proteasome AAA-ATPase subunit RPT3 [Arabidopsis thaliana] gi|8777330|dbj|BAA96920.1| 26S proteasome AAA-ATPase subunit RPT3 [Arabidopsis thaliana] gi|17979231|gb|AAL49932.1| AT4g10340/F24G24_140 [Arabidopsis thaliana] gi|56382019|gb|AAV85728.1| At5g58290 [Arabidopsis thaliana] gi|297310396|gb|EFH40820.1| hypothetical protein ARALYDRAFT_495939 [Arabidopsis lyrata subsp. lyrata] gi|332009646|gb|AED97029.1| regulatory particle triple-A ATPase 3 [Arabidopsis thaliana] gi|482548338|gb|EOA12532.1| hypothetical protein CARUB_v10026512mg [Capsella rubella] Length = 408 Score = 97.8 bits (242), Expect = 3e-18 Identities = 45/47 (95%), Positives = 47/47 (100%) Frame = -1 Query: 367 AAEIAAICQEAGLHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 227 AAEIAAICQEAG+HAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFYK Sbjct: 362 AAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 408 >ref|XP_012486311.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Gossypium raimondii] gi|763769856|gb|KJB37071.1| hypothetical protein B456_006G188400 [Gossypium raimondii] Length = 420 Score = 97.8 bits (242), Expect = 3e-18 Identities = 45/47 (95%), Positives = 47/47 (100%) Frame = -1 Query: 367 AAEIAAICQEAGLHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 227 AAEIAAICQEAG+HAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFYK Sbjct: 374 AAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 420 >ref|XP_011040698.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Populus euphratica] Length = 412 Score = 97.8 bits (242), Expect = 3e-18 Identities = 45/47 (95%), Positives = 47/47 (100%) Frame = -1 Query: 367 AAEIAAICQEAGLHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 227 AAEIAAICQEAG+HAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFYK Sbjct: 366 AAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 412 >gb|KHN18648.1| 26S protease regulatory subunit 6B like [Glycine soja] Length = 326 Score = 97.8 bits (242), Expect = 3e-18 Identities = 45/47 (95%), Positives = 47/47 (100%) Frame = -1 Query: 367 AAEIAAICQEAGLHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 227 AAEIAAICQEAG+HAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFYK Sbjct: 280 AAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 326 >gb|KHG28345.1| 26S protease regulatory subunit 6B -like protein [Gossypium arboreum] Length = 416 Score = 97.8 bits (242), Expect = 3e-18 Identities = 45/47 (95%), Positives = 47/47 (100%) Frame = -1 Query: 367 AAEIAAICQEAGLHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 227 AAEIAAICQEAG+HAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFYK Sbjct: 370 AAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 416 >gb|KHG22968.1| 26S protease regulatory subunit 6B -like protein [Gossypium arboreum] Length = 417 Score = 97.8 bits (242), Expect = 3e-18 Identities = 45/47 (95%), Positives = 47/47 (100%) Frame = -1 Query: 367 AAEIAAICQEAGLHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 227 AAEIAAICQEAG+HAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFYK Sbjct: 371 AAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 417