BLASTX nr result
ID: Perilla23_contig00001582
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00001582 (372 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007027282.1| PLAC8 family protein isoform 2 [Theobroma ca... 117 3e-24 ref|XP_007027281.1| PLAC8 family protein isoform 1 [Theobroma ca... 117 3e-24 ref|XP_008369780.1| PREDICTED: cell number regulator 8-like [Mal... 117 3e-24 ref|XP_012443337.1| PREDICTED: cell number regulator 8-like [Gos... 117 4e-24 ref|XP_002279879.1| PREDICTED: cell number regulator 8 [Vitis vi... 116 7e-24 emb|CDP06719.1| unnamed protein product [Coffea canephora] 115 1e-23 ref|XP_008239248.1| PREDICTED: cell number regulator 8 [Prunus m... 114 2e-23 ref|XP_007205585.1| hypothetical protein PRUPE_ppa008853mg [Prun... 114 2e-23 ref|XP_006428830.1| hypothetical protein CICLE_v10012548mg [Citr... 114 3e-23 ref|XP_010696404.1| PREDICTED: cell number regulator 8 [Beta vul... 114 4e-23 ref|XP_009358156.1| PREDICTED: cell number regulator 8 [Pyrus x ... 114 4e-23 ref|XP_009342642.1| PREDICTED: cell number regulator 8-like [Pyr... 113 5e-23 ref|XP_008387616.1| PREDICTED: cell number regulator 8-like [Mal... 113 5e-23 ref|XP_010107569.1| hypothetical protein L484_024425 [Morus nota... 113 6e-23 gb|AGE81872.1| cell number regulator 20, partial [Prunus avium] 113 6e-23 ref|XP_014494733.1| PREDICTED: cell number regulator 8 [Vigna ra... 112 8e-23 gb|KOM38978.1| hypothetical protein LR48_Vigan03g236000 [Vigna a... 112 8e-23 ref|XP_006381481.1| hypothetical protein POPTR_0006s13240g [Popu... 112 8e-23 gb|AGJ98233.1| PIB60 cell number regulator-like protein, partial... 112 8e-23 gb|AFK42661.1| unknown [Lotus japonicus] 112 8e-23 >ref|XP_007027282.1| PLAC8 family protein isoform 2 [Theobroma cacao] gi|508715887|gb|EOY07784.1| PLAC8 family protein isoform 2 [Theobroma cacao] Length = 248 Score = 117 bits (294), Expect = 3e-24 Identities = 50/55 (90%), Positives = 54/55 (98%) Frame = -2 Query: 371 EQCETACDFATHVFCHACALCQEGREVRRRLPHPGFNTQPVLVMIPPGDQTMGRG 207 EQCE+ACDFATHVFCHACALCQEGRE+RRRLPHPGFN QPVLVM+PPG+QTMGRG Sbjct: 193 EQCESACDFATHVFCHACALCQEGRELRRRLPHPGFNAQPVLVMMPPGEQTMGRG 247 >ref|XP_007027281.1| PLAC8 family protein isoform 1 [Theobroma cacao] gi|508715886|gb|EOY07783.1| PLAC8 family protein isoform 1 [Theobroma cacao] Length = 280 Score = 117 bits (294), Expect = 3e-24 Identities = 50/55 (90%), Positives = 54/55 (98%) Frame = -2 Query: 371 EQCETACDFATHVFCHACALCQEGREVRRRLPHPGFNTQPVLVMIPPGDQTMGRG 207 EQCE+ACDFATHVFCHACALCQEGRE+RRRLPHPGFN QPVLVM+PPG+QTMGRG Sbjct: 225 EQCESACDFATHVFCHACALCQEGRELRRRLPHPGFNAQPVLVMMPPGEQTMGRG 279 >ref|XP_008369780.1| PREDICTED: cell number regulator 8-like [Malus domestica] gi|658040091|ref|XP_008355639.1| PREDICTED: cell number regulator 8-like [Malus domestica] Length = 246 Score = 117 bits (293), Expect = 3e-24 Identities = 50/55 (90%), Positives = 52/55 (94%) Frame = -2 Query: 371 EQCETACDFATHVFCHACALCQEGREVRRRLPHPGFNTQPVLVMIPPGDQTMGRG 207 EQCETACDFATHVFCH CALCQEGRE+RRRLPHPGFN QPVLVMIPPG+Q MGRG Sbjct: 191 EQCETACDFATHVFCHPCALCQEGREIRRRLPHPGFNAQPVLVMIPPGEQAMGRG 245 >ref|XP_012443337.1| PREDICTED: cell number regulator 8-like [Gossypium raimondii] gi|763795496|gb|KJB62492.1| hypothetical protein B456_009G419400 [Gossypium raimondii] Length = 240 Score = 117 bits (292), Expect = 4e-24 Identities = 50/55 (90%), Positives = 53/55 (96%) Frame = -2 Query: 371 EQCETACDFATHVFCHACALCQEGREVRRRLPHPGFNTQPVLVMIPPGDQTMGRG 207 EQCE+ACDFATHVFCHACALC EGRE+RRRLPHPGFN QPVLVMIPPG+QTMGRG Sbjct: 185 EQCESACDFATHVFCHACALCHEGRELRRRLPHPGFNAQPVLVMIPPGEQTMGRG 239 >ref|XP_002279879.1| PREDICTED: cell number regulator 8 [Vitis vinifera] Length = 240 Score = 116 bits (290), Expect = 7e-24 Identities = 50/54 (92%), Positives = 52/54 (96%) Frame = -2 Query: 371 EQCETACDFATHVFCHACALCQEGREVRRRLPHPGFNTQPVLVMIPPGDQTMGR 210 E CETACDFATHVFCHACALCQEGRE+RRRLPHPGFN QPVLVMIPPG+QTMGR Sbjct: 184 EHCETACDFATHVFCHACALCQEGRELRRRLPHPGFNAQPVLVMIPPGEQTMGR 237 >emb|CDP06719.1| unnamed protein product [Coffea canephora] Length = 245 Score = 115 bits (288), Expect = 1e-23 Identities = 51/55 (92%), Positives = 51/55 (92%) Frame = -2 Query: 371 EQCETACDFATHVFCHACALCQEGREVRRRLPHPGFNTQPVLVMIPPGDQTMGRG 207 EQCETACDFATHVFCHACALCQEGREVRRRL HPGFN PVLVMIPPGDQ MGRG Sbjct: 190 EQCETACDFATHVFCHACALCQEGREVRRRLHHPGFNAHPVLVMIPPGDQIMGRG 244 >ref|XP_008239248.1| PREDICTED: cell number regulator 8 [Prunus mume] Length = 220 Score = 114 bits (286), Expect = 2e-23 Identities = 49/55 (89%), Positives = 52/55 (94%) Frame = -2 Query: 371 EQCETACDFATHVFCHACALCQEGREVRRRLPHPGFNTQPVLVMIPPGDQTMGRG 207 EQCETACDFATHVFCHACALCQEGRE+RRR+ HPGFN QPVLVMIPPG+Q MGRG Sbjct: 165 EQCETACDFATHVFCHACALCQEGREIRRRMLHPGFNAQPVLVMIPPGEQAMGRG 219 >ref|XP_007205585.1| hypothetical protein PRUPE_ppa008853mg [Prunus persica] gi|462401227|gb|EMJ06784.1| hypothetical protein PRUPE_ppa008853mg [Prunus persica] Length = 317 Score = 114 bits (286), Expect = 2e-23 Identities = 49/55 (89%), Positives = 52/55 (94%) Frame = -2 Query: 371 EQCETACDFATHVFCHACALCQEGREVRRRLPHPGFNTQPVLVMIPPGDQTMGRG 207 EQCETACDFATHVFCHACALCQEGRE+RRR+ HPGFN QPVLVMIPPG+Q MGRG Sbjct: 262 EQCETACDFATHVFCHACALCQEGREIRRRMLHPGFNAQPVLVMIPPGEQAMGRG 316 >ref|XP_006428830.1| hypothetical protein CICLE_v10012548mg [Citrus clementina] gi|568854039|ref|XP_006480643.1| PREDICTED: cell number regulator 8-like [Citrus sinensis] gi|557530887|gb|ESR42070.1| hypothetical protein CICLE_v10012548mg [Citrus clementina] Length = 253 Score = 114 bits (285), Expect = 3e-23 Identities = 47/55 (85%), Positives = 53/55 (96%) Frame = -2 Query: 371 EQCETACDFATHVFCHACALCQEGREVRRRLPHPGFNTQPVLVMIPPGDQTMGRG 207 EQCE++CDFATHVFCH CALCQEGRE+RRR+PHPGFN QPVLVM+PPG+QTMGRG Sbjct: 198 EQCESSCDFATHVFCHLCALCQEGRELRRRMPHPGFNAQPVLVMLPPGEQTMGRG 252 >ref|XP_010696404.1| PREDICTED: cell number regulator 8 [Beta vulgaris subsp. vulgaris] gi|870843889|gb|KMS96977.1| hypothetical protein BVRB_7g179840 [Beta vulgaris subsp. vulgaris] Length = 253 Score = 114 bits (284), Expect = 4e-23 Identities = 48/54 (88%), Positives = 51/54 (94%) Frame = -2 Query: 371 EQCETACDFATHVFCHACALCQEGREVRRRLPHPGFNTQPVLVMIPPGDQTMGR 210 EQCETACDFATHVFCH C+LCQEGRE+RRRLPHPGFN QPVLVMIPPG+Q MGR Sbjct: 197 EQCETACDFATHVFCHPCSLCQEGREIRRRLPHPGFNAQPVLVMIPPGEQAMGR 250 >ref|XP_009358156.1| PREDICTED: cell number regulator 8 [Pyrus x bretschneideri] Length = 246 Score = 114 bits (284), Expect = 4e-23 Identities = 49/55 (89%), Positives = 51/55 (92%) Frame = -2 Query: 371 EQCETACDFATHVFCHACALCQEGREVRRRLPHPGFNTQPVLVMIPPGDQTMGRG 207 EQCETACDFATHVFCH CALCQEGRE+RRRLPHPGFN QPVLVMIPP +Q MGRG Sbjct: 191 EQCETACDFATHVFCHPCALCQEGREIRRRLPHPGFNAQPVLVMIPPVEQAMGRG 245 >ref|XP_009342642.1| PREDICTED: cell number regulator 8-like [Pyrus x bretschneideri] Length = 251 Score = 113 bits (283), Expect = 5e-23 Identities = 49/55 (89%), Positives = 51/55 (92%) Frame = -2 Query: 371 EQCETACDFATHVFCHACALCQEGREVRRRLPHPGFNTQPVLVMIPPGDQTMGRG 207 EQCETACDFATHVFCH CALCQEGRE+RRRLPHPGFN QPVLVMIPP +Q MGRG Sbjct: 196 EQCETACDFATHVFCHPCALCQEGREIRRRLPHPGFNAQPVLVMIPPEEQGMGRG 250 >ref|XP_008387616.1| PREDICTED: cell number regulator 8-like [Malus domestica] Length = 251 Score = 113 bits (283), Expect = 5e-23 Identities = 49/55 (89%), Positives = 51/55 (92%) Frame = -2 Query: 371 EQCETACDFATHVFCHACALCQEGREVRRRLPHPGFNTQPVLVMIPPGDQTMGRG 207 EQCETACDFATHVFCH CALCQEGRE+RRRLPHPGFN QPVLVMIPP +Q MGRG Sbjct: 196 EQCETACDFATHVFCHPCALCQEGREIRRRLPHPGFNAQPVLVMIPPEEQGMGRG 250 >ref|XP_010107569.1| hypothetical protein L484_024425 [Morus notabilis] gi|587929076|gb|EXC16251.1| hypothetical protein L484_024425 [Morus notabilis] Length = 292 Score = 113 bits (282), Expect = 6e-23 Identities = 48/55 (87%), Positives = 51/55 (92%) Frame = -2 Query: 371 EQCETACDFATHVFCHACALCQEGREVRRRLPHPGFNTQPVLVMIPPGDQTMGRG 207 EQCETACDFATH+FCH CALCQEGRE+RRRLPHPGFN Q VLVMIPP +QTMGRG Sbjct: 237 EQCETACDFATHIFCHTCALCQEGRELRRRLPHPGFNAQAVLVMIPPAEQTMGRG 291 >gb|AGE81872.1| cell number regulator 20, partial [Prunus avium] Length = 146 Score = 113 bits (282), Expect = 6e-23 Identities = 48/55 (87%), Positives = 51/55 (92%) Frame = -2 Query: 371 EQCETACDFATHVFCHACALCQEGREVRRRLPHPGFNTQPVLVMIPPGDQTMGRG 207 EQCETACDFATHVFCH CALCQEGRE+RRRL HPGFN QP+LVMIPPG+Q MGRG Sbjct: 91 EQCETACDFATHVFCHPCALCQEGREIRRRLLHPGFNAQPILVMIPPGEQAMGRG 145 >ref|XP_014494733.1| PREDICTED: cell number regulator 8 [Vigna radiata var. radiata] Length = 227 Score = 112 bits (281), Expect = 8e-23 Identities = 48/54 (88%), Positives = 51/54 (94%) Frame = -2 Query: 371 EQCETACDFATHVFCHACALCQEGREVRRRLPHPGFNTQPVLVMIPPGDQTMGR 210 EQCE+ACD ATHVFCH CALCQEGRE+RRRLPHPGFN QPVLVMIPPG+QTMGR Sbjct: 172 EQCESACDLATHVFCHVCALCQEGRELRRRLPHPGFNAQPVLVMIPPGEQTMGR 225 >gb|KOM38978.1| hypothetical protein LR48_Vigan03g236000 [Vigna angularis] Length = 227 Score = 112 bits (281), Expect = 8e-23 Identities = 48/54 (88%), Positives = 51/54 (94%) Frame = -2 Query: 371 EQCETACDFATHVFCHACALCQEGREVRRRLPHPGFNTQPVLVMIPPGDQTMGR 210 EQCE+ACD ATHVFCH CALCQEGRE+RRRLPHPGFN QPVLVMIPPG+QTMGR Sbjct: 172 EQCESACDLATHVFCHVCALCQEGRELRRRLPHPGFNAQPVLVMIPPGEQTMGR 225 >ref|XP_006381481.1| hypothetical protein POPTR_0006s13240g [Populus trichocarpa] gi|550336184|gb|ERP59278.1| hypothetical protein POPTR_0006s13240g [Populus trichocarpa] Length = 248 Score = 112 bits (281), Expect = 8e-23 Identities = 48/55 (87%), Positives = 52/55 (94%) Frame = -2 Query: 371 EQCETACDFATHVFCHACALCQEGREVRRRLPHPGFNTQPVLVMIPPGDQTMGRG 207 EQCETACDFATHVFCH ALCQEGRE+RRR+PHPGFN QPVLVMIPPG+Q+MGRG Sbjct: 193 EQCETACDFATHVFCHPLALCQEGREIRRRVPHPGFNAQPVLVMIPPGEQSMGRG 247 >gb|AGJ98233.1| PIB60 cell number regulator-like protein, partial [Petunia x hybrida] Length = 228 Score = 112 bits (281), Expect = 8e-23 Identities = 48/54 (88%), Positives = 51/54 (94%) Frame = -2 Query: 371 EQCETACDFATHVFCHACALCQEGREVRRRLPHPGFNTQPVLVMIPPGDQTMGR 210 EQCE+ACDFATH+FCH CALCQEGRE+RRRLPHPGFN Q VLVMIPPGDQTMGR Sbjct: 175 EQCESACDFATHIFCHPCALCQEGRELRRRLPHPGFNAQQVLVMIPPGDQTMGR 228 >gb|AFK42661.1| unknown [Lotus japonicus] Length = 234 Score = 112 bits (281), Expect = 8e-23 Identities = 48/54 (88%), Positives = 51/54 (94%) Frame = -2 Query: 371 EQCETACDFATHVFCHACALCQEGREVRRRLPHPGFNTQPVLVMIPPGDQTMGR 210 EQCE+ACD ATHVFCH CALCQEGRE+RRRLPHPGFN QPVLVMIPPG+QTMGR Sbjct: 179 EQCESACDLATHVFCHVCALCQEGRELRRRLPHPGFNAQPVLVMIPPGEQTMGR 232