BLASTX nr result
ID: Perilla23_contig00001527
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00001527 (376 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AJD25179.1| cytochrome P450 CYP76A35 [Salvia miltiorrhiza] 76 9e-12 gb|ALM25795.1| cytochrome P450 76A35-like protein [Salvia pomifera] 75 1e-11 >gb|AJD25179.1| cytochrome P450 CYP76A35 [Salvia miltiorrhiza] Length = 503 Score = 76.3 bits (186), Expect = 9e-12 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = -3 Query: 374 LIQSFDWELPANVSLETLDMRDVAGVSLRLFTPLKAVPRERGA 246 LIQSFDWELPAN+S ETLDMR++ G+SLR+ TPLKAVPRERGA Sbjct: 461 LIQSFDWELPANISPETLDMREMTGLSLRMITPLKAVPRERGA 503 >gb|ALM25795.1| cytochrome P450 76A35-like protein [Salvia pomifera] Length = 510 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -3 Query: 374 LIQSFDWELPANVSLETLDMRDVAGVSLRLFTPLKAVPRERG 249 L+QSFDWELPANVS ETLDMRD+ G+SLR+ TPLKAVPRERG Sbjct: 468 LMQSFDWELPANVSPETLDMRDMTGLSLRMMTPLKAVPRERG 509