BLASTX nr result
ID: Perilla23_contig00000903
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00000903 (350 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011101904.1| PREDICTED: uncharacterized protein LOC105179... 67 4e-09 >ref|XP_011101904.1| PREDICTED: uncharacterized protein LOC105179942 [Sesamum indicum] Length = 313 Score = 67.4 bits (163), Expect = 4e-09 Identities = 38/61 (62%), Positives = 45/61 (73%), Gaps = 4/61 (6%) Frame = +3 Query: 177 HIVPSSRL---ALFPGSLAAAAVKCSNNGSAAS-DEGSLKDILSGIVDERVEQLLNKEEN 344 HI+PS +L A F S A AV CS NGS S + GSLKD+LSG+VDERVE+LLNKEEN Sbjct: 24 HIIPSIKLTTVAPFATSRRAVAVNCSKNGSPGSGNAGSLKDLLSGMVDERVEELLNKEEN 83 Query: 345 K 347 + Sbjct: 84 R 84