BLASTX nr result
ID: Perilla23_contig00000154
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00000154 (540 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAB86429.1| putative protein [Arabidopsis thaliana] 42 1e-06 ref|XP_011078869.1| PREDICTED: serine/threonine-protein kinase N... 57 7e-06 >emb|CAB86429.1| putative protein [Arabidopsis thaliana] Length = 530 Score = 42.0 bits (97), Expect(2) = 1e-06 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = +1 Query: 451 PGEVVATPNYMSLELLAYIPYGSKSDM 531 P EVV TP+YM ELLA IPYGSKSD+ Sbjct: 135 PEEVVGTPSYMCPELLADIPYGSKSDI 161 Score = 37.0 bits (84), Expect(2) = 1e-06 Identities = 12/30 (40%), Positives = 22/30 (73%) Frame = +2 Query: 377 ICILTNYCEGGDMSNIIRSPRGTYYPERLL 466 +CI+ YC+GGDM++ I+ G ++PE ++ Sbjct: 110 VCIVIGYCQGGDMTDTIKRACGVHFPEEVV 139 >ref|XP_011078869.1| PREDICTED: serine/threonine-protein kinase Nek6-like [Sesamum indicum] Length = 653 Score = 56.6 bits (135), Expect = 7e-06 Identities = 27/56 (48%), Positives = 34/56 (60%), Gaps = 8/56 (14%) Frame = +2 Query: 371 SCICILTNYCEGGDMSNIIRSPRGTYYPERLLRLLIICPW--------SFLHISRM 514 SCICI+TNYCEGGD+S +IR RG Y+PE IC W +LH +R+ Sbjct: 86 SCICIVTNYCEGGDISELIRKARGAYFPEEK-----ICKWLTQLLLAIDYLHSNRV 136