BLASTX nr result
ID: Perilla23_contig00000092
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00000092 (917 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097925.1| PREDICTED: autophagy-related protein 18f [Se... 69 7e-09 ref|XP_012841721.1| PREDICTED: autophagy-related protein 18f iso... 63 4e-07 ref|XP_012841720.1| PREDICTED: autophagy-related protein 18f iso... 63 4e-07 ref|XP_012841719.1| PREDICTED: autophagy-related protein 18f iso... 63 4e-07 >ref|XP_011097925.1| PREDICTED: autophagy-related protein 18f [Sesamum indicum] Length = 893 Score = 68.6 bits (166), Expect = 7e-09 Identities = 33/42 (78%), Positives = 38/42 (90%), Gaps = 1/42 (2%) Frame = -1 Query: 125 MRNDSQKSGDGGAVVPR-GRVNNGILPNSFRAFSSYLKIVSS 3 MRND QKSGDGGA+VPR GR NNGI+PNSF+A SSYL++VSS Sbjct: 1 MRNDGQKSGDGGALVPRPGRGNNGIIPNSFKALSSYLRVVSS 42 >ref|XP_012841721.1| PREDICTED: autophagy-related protein 18f isoform X3 [Erythranthe guttatus] Length = 741 Score = 62.8 bits (151), Expect = 4e-07 Identities = 34/46 (73%), Positives = 37/46 (80%), Gaps = 5/46 (10%) Frame = -1 Query: 125 MRNDSQKSGDGG--AVVPR---GRVNNGILPNSFRAFSSYLKIVSS 3 MRND QKSGDGG A+VPR GR NNGI+PNSF+ SSYLKIVSS Sbjct: 1 MRNDGQKSGDGGGGAMVPRSSGGRGNNGIIPNSFKTLSSYLKIVSS 46 >ref|XP_012841720.1| PREDICTED: autophagy-related protein 18f isoform X2 [Erythranthe guttatus] Length = 812 Score = 62.8 bits (151), Expect = 4e-07 Identities = 34/46 (73%), Positives = 37/46 (80%), Gaps = 5/46 (10%) Frame = -1 Query: 125 MRNDSQKSGDGG--AVVPR---GRVNNGILPNSFRAFSSYLKIVSS 3 MRND QKSGDGG A+VPR GR NNGI+PNSF+ SSYLKIVSS Sbjct: 1 MRNDGQKSGDGGGGAMVPRSSGGRGNNGIIPNSFKTLSSYLKIVSS 46 >ref|XP_012841719.1| PREDICTED: autophagy-related protein 18f isoform X1 [Erythranthe guttatus] Length = 829 Score = 62.8 bits (151), Expect = 4e-07 Identities = 34/46 (73%), Positives = 37/46 (80%), Gaps = 5/46 (10%) Frame = -1 Query: 125 MRNDSQKSGDGG--AVVPR---GRVNNGILPNSFRAFSSYLKIVSS 3 MRND QKSGDGG A+VPR GR NNGI+PNSF+ SSYLKIVSS Sbjct: 1 MRNDGQKSGDGGGGAMVPRSSGGRGNNGIIPNSFKTLSSYLKIVSS 46