BLASTX nr result
ID: Perilla23_contig00000089
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00000089 (348 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011076274.1| PREDICTED: glycosyltransferase family 64 pro... 60 5e-07 ref|XP_011076273.1| PREDICTED: glycosyltransferase family 64 pro... 60 5e-07 ref|XP_012852105.1| PREDICTED: glycosyltransferase family 64 pro... 58 2e-06 >ref|XP_011076274.1| PREDICTED: glycosyltransferase family 64 protein C4-like isoform X2 [Sesamum indicum] Length = 352 Score = 60.5 bits (145), Expect = 5e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -3 Query: 172 MSTLIAIREASLNGNGGEYSPAKEKASSRGVY 77 MSTLI IREASLNGNGG+YSPAKEKA++RGVY Sbjct: 1 MSTLITIREASLNGNGGDYSPAKEKAANRGVY 32 >ref|XP_011076273.1| PREDICTED: glycosyltransferase family 64 protein C4-like isoform X1 [Sesamum indicum] Length = 353 Score = 60.5 bits (145), Expect = 5e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -3 Query: 172 MSTLIAIREASLNGNGGEYSPAKEKASSRGVY 77 MSTLI IREASLNGNGG+YSPAKEKA++RGVY Sbjct: 1 MSTLITIREASLNGNGGDYSPAKEKAANRGVY 32 >ref|XP_012852105.1| PREDICTED: glycosyltransferase family 64 protein C4-like [Erythranthe guttatus] gi|604305969|gb|EYU25026.1| hypothetical protein MIMGU_mgv1a009124mg [Erythranthe guttata] Length = 352 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -3 Query: 172 MSTLIAIREASLNGNGGEYSPAKEKASSRGVY 77 MSTLIAIREASL+GNGGEYSPAK K S+RGVY Sbjct: 1 MSTLIAIREASLSGNGGEYSPAKVKGSNRGVY 32