BLASTX nr result
ID: Papaver32_contig00046234
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00046234 (443 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OEL31721.1 hypothetical protein BAE44_0007262 [Dichanthelium oli... 54 9e-06 >OEL31721.1 hypothetical protein BAE44_0007262 [Dichanthelium oligosanthes] Length = 216 Score = 53.5 bits (127), Expect = 9e-06 Identities = 24/38 (63%), Positives = 28/38 (73%) Frame = -1 Query: 434 LCLDSKGNRLDFHFKLNKIKPGI*KERDPMDGIMDFMK 321 LC SKGN +D HFK +K KP + KE+DPM GIMD MK Sbjct: 145 LCKASKGNWIDLHFKEDKFKPSMDKEKDPMSGIMDLMK 182