BLASTX nr result
ID: Papaver32_contig00042965
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00042965 (498 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAY38946.1 hypothetical protein MANES_10G055200 [Manihot esculenta] 42 9e-06 >OAY38946.1 hypothetical protein MANES_10G055200 [Manihot esculenta] Length = 1895 Score = 42.0 bits (97), Expect(3) = 9e-06 Identities = 18/32 (56%), Positives = 24/32 (75%) Frame = -2 Query: 416 DEIPTSDLDEIAAIHINMEELTLSVQNYMQEN 321 ++I D DEI I +NMEELT+++QNYMQ N Sbjct: 1637 EDINNEDTDEIPTIKLNMEELTMNLQNYMQAN 1668 Score = 30.0 bits (66), Expect(3) = 9e-06 Identities = 17/29 (58%), Positives = 20/29 (68%), Gaps = 2/29 (6%) Frame = -1 Query: 303 ALVASNNHLIS--APKLKSVFQLRTKHQV 223 ALVA N S PKLK+V +LRT+HQV Sbjct: 1679 ALVALNQEAASIPTPKLKNVSRLRTEHQV 1707 Score = 23.5 bits (49), Expect(3) = 9e-06 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -3 Query: 493 PASPKSEHIDATVSNIE 443 PA+P+ EH + T S+IE Sbjct: 1621 PATPEQEHNEVTESDIE 1637