BLASTX nr result
ID: Papaver32_contig00042737
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00042737 (460 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019190773.1 PREDICTED: uncharacterized protein LOC109185246 [... 55 9e-06 >XP_019190773.1 PREDICTED: uncharacterized protein LOC109185246 [Ipomoea nil] Length = 1342 Score = 54.7 bits (130), Expect = 9e-06 Identities = 24/44 (54%), Positives = 31/44 (70%) Frame = -1 Query: 139 MSILAWNCQGLNQQNTIQHLRSLISLHKPSFVFLSETLATRNHM 8 MSIL+WNC+GL T+Q L L+S +PSFVFL ET A + H+ Sbjct: 1 MSILSWNCRGLGGDRTVQELLGLVSSQQPSFVFLMETKAMKTHV 44